KEGG   Bifidobacterium thermophilum: D805_0116Help
Entry
D805_0116         CDS       T02505                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
btp  Bifidobacterium thermophilum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D805_0116
Enzymes [BR:btp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     D805_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
129934..131445
Genome map
AA seq 503 aa AA seqDB search
MKNKVQLITYANRLGEGTIKSLTDVLRTRFDGVYEGVHILPFFTPFDGADAGFDPVDHTK
VDPRLGTWDDIAELSKTHDIMVDTIVNHMSWESKQFQDVMKRGEDSPYYPMFLTMSSVFP
DGATEEDLAGIYRPRPGLPFTHYTWGGKTRLVWTTFTPQQVDIDTDSKEGWDYLLSILDQ
LSRSHVSYIRLDAVGYGAKQAKTSCFMTPKTFDLIGRIKAEAESRGLETLIEVHSYYKKQ
VAIANKVDRVYDFAIPGLLLHALTTGKTEPIAKWVEVRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEEVDQLVETIHENTHGESRAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGANDMELLHRTNVGRDINRHYYSVEEIDRNLERPVV
KALNALCRMRNQLDAFDGEFTFSHEGDTLTFDWKGETTSATLTFEPKRGLGVDNQASVCT
LRWSDAAGEHETDDLLAAPPTVA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagtccagctcatcacctatgccaaccggttaggcgagggcaccatcaag
tccttgaccgacgtgctgcgcacccgctttgacggtgtctacgaaggcgtgcacatcctg
ccgtttttcaccccgttcgacggcgccgacgccggattcgacccggtggaccacaccaag
gtcgatccgcgcctgggcacatgggatgatatcgccgagctgtccaagacccacgacatc
atggtcgacaccatcgtcaaccacatgtcctgggaatccaagcaattccaagacgtcatg
aagcgcggcgaagacagcccctactacccgatgttcctcaccatgtcgagcgtcttcccc
gacggcgccaccgaagaggacctcgccggcatctaccgtccgcgcccgggcctgccgttc
acccactacacgtggggcggcaagacccgtctcgtgtggaccaccttcaccccgcagcag
gtcgatatcgacaccgattccaaggagggttgggattacctgctgtccatcctcgaccag
ctgtcgcgcagccacgtgagctacatccgtctcgacgcggtcggctacggcgccaaacag
gctaagaccagctgcttcatgacccccaagaccttcgacctcattggccggattaaggcg
gaagccgaatcccgcggtctcgaaacgctgatcgaagtgcactcctactacaagaagcag
gtcgccatcgccaacaaggttgatcgcgtctacgatttcgcgattccgggcctgctgctg
cacgccctgaccaccggcaagaccgagccgatcgccaagtgggtcgaggtgcgcccgaac
aacgcggtcaccgtactcgacacgcatgacggcatcggcgtcatcgacatcggttccgac
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggaagtcgaccagctcgtcgaa
accatccacgagaacacccacggcgaatcccgcgccgcgaccggtgccgccgccagcaac
ctcgacctctatcaggtcaattccacgtattattcggcgctcggttgcaacgaccagcat
tacctcgccgcgcgggccgtgcagttcttcctgcccggcgtgccgcaggtgtactatgtc
ggcgcgctcgccggcgcgaacgacatggagctgctgcatcgcacgaatgtcggccgcgac
atcaatcgccactattattcggtggaggaaatcgatcgcaatctcgaacgtccggtcgtc
aaggcgctcaatgccttgtgccgcatgcgcaaccagcttgacgcattcgacggcgagttc
accttcagtcatgagggcgacacgctgaccttcgattggaagggcgagaccacgtcggca
acccttacgttcgaaccgaaacgcggcctgggtgttgataaccaggcttccgtgtgcacg
ctgcgctggtcggatgcagctggcgagcatgaaaccgacgacctgctggccgctccgccg
acagtcgcctga

DBGET integrated database retrieval system