KEGG   Bifidobacterium thermophilum: D805_0646Help
Entry
D805_0646         CDS       T02505                                 

Definition
Glycoside Hydrolase Family 5 candidate endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
btp  Bifidobacterium thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D805_0646
Enzymes [BR:btp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     D805_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815836..818034
Genome map
AA seq 732 aa AA seqDB search
MTSTSQPLSRILAAIAASAMLATGCATGVAAVSAQSAVAAQPAAASSVDYTQAMKSFTAD
ASGDQLAYAVNGELKDVAYKDTPVGRHGKLSIGKAAGFSAPTVLDEHGQPFQLRGASTHG
VQWFPQYINRDAFQSLRDEWGINMVRLALYPREGGYLQGSQAKMDAKIEEAVTAANELGM
YVILDWHVLNYNPNEDAAKAEEFFTKYAAKYKNLKNVLYEIDNEPTSTSWYDGSGNDLYT
YSKRITKAIRATGSQSIVICGTNTWSQDVDAVAAKPLSADGITNVAYTLHFYAGTHYDNI
KNKLRTALSAGTPVFVSEFGITDASGWGGIDIANANDWMTLLTRNNISYAAWSLCNKGEG
ASYLKESTGKTSKWTGSELSTSGIWLVNTSRRILAMVDGVSQSGSGGTGETPTDPTPDPT
PDPTPDPTPDPTPSEPTDPTTPTDPTEPSDPQTTTTGLTVEAKVSSDWGMGANVNVTVSN
PSDAMYKGGWKVEFDLAGTITNLWCGKIVSHTGNHYVVSDASWNASIAPKHGTSFGFGMT
KAPTSSALPTNLTVNGAAADASQGTSDGASAGISEGTSQESGAAESSKDSTDQKAPDAPK
ASDDQKTSDGQKTDSSDSQSTDTKPADPTPAASDLTVEAKVNSNWMLGATVQVEVGNTTD
TAHEGGWTVEFDLDGDITNLWNGTIASHKGDHYVITNASWNGTIWAKKNATLGFTMSKSL
FADAQPTNLTVR
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcaaccagtcagccattgtcgcggatactcgcggcgatcgcagccagtgcaatg
ctggcaacagggtgcgcgacaggcgttgcagccgtgtccgcgcagtccgccgtcgcagcc
cagccagctgctgcgagcagtgtggactacacgcaggcgatgaagtctttcaccgcggac
gccagcggcgatcagctcgcctacgcggtcaacggcgagttgaaggacgtggcttacaaa
gacactccggtaggccggcacggcaagctgtccatcggcaaggcggcaggattcagcgcg
ccgaccgtactcgacgagcatggtcagcccttccagctgcgcggcgcgagcacacacggc
gtgcaatggttccctcagtacatcaaccgcgatgcattccagtcgttgcgcgacgaatgg
ggcatcaacatggtgcgactggcgctctacccgcgtgaaggtggctacctgcagggctca
caagcgaagatggatgccaaaatcgaagaagccgtcaccgctgccaacgagctcggcatg
tacgtcatcctcgactggcatgtcctcaactacaaccccaacgaggacgccgccaaggca
gaagagttcttcaccaaatatgctgccaagtacaagaatctgaagaacgtcctgtacgaa
atcgacaacgagccgacatcaacctcctggtatgacggctccggcaacgacctgtacacg
tacagcaagcgcatcaccaaagcgattcgcgccaccggcagccagtccatcgtcatctgc
ggaaccaacacgtggtcgcaagacgtggacgcggtcgcagccaaaccgttgtccgccgac
gggatcaccaacgtggcatacacgctgcacttctatgcgggcacgcattacgacaacatc
aagaacaagctgcgtacggctttgtccgccggtacaccggtgtttgtctccgaattcggc
atcaccgacgcgtccggctggggcgggatcgacatcgccaacgcgaacgattggatgacg
ctgctgacgcgcaacaacatcagctacgccgcttggtcgctgtgcaacaagggggaggga
gcctcctacctgaaggaatccacgggcaagaccagcaagtggaccggcagcgaactgtcc
accagcggtatctggctggtcaacaccagtcgccgcatcctggccatggtcgatggcgtg
agccaatcaggtagcggcggcactggtgagacgccaaccgatccgacacctgatccgacg
cctgaccccacgcctgatccgacgcctgaccccacgccgagcgaaccgactgacccaacc
accccgaccgaccccaccgaaccgagtgatccacagaccacaaccaccgggctgaccgtc
gaagcgaaagtcagcagcgattggggtatgggtgcgaacgtcaacgtgaccgtcagcaac
ccatccgacgccatgtacaagggcggctggaaggtcgagttcgacctggcaggcaccatc
accaacctgtggtgcggcaagatcgtcagccataccggcaatcactacgtggtttcagac
gcctcgtggaatgcttcgatcgcgccgaaacacggcacatccttcggcttcggcatgaca
aaggctccgaccagcagcgcgctgccgacgaatctgacggtgaacggtgccgctgcggac
gcttcgcaaggcacttcggatggggcgtcggctgggatttcggaagggacgtcgcaggaa
tccggtgcggcggaatcgtcgaaggattcaactgatcagaaggctcccgacgctccgaaa
gcatccgatgatcagaagacatccgatggccagaagactgactcctcagactcccagtcg
actgacaccaagcctgcagatcccacgccagccgcctcggatctaaccgttgaagcgaaa
gtcaacagcaattggatgctcggcgcaacggttcaggtggaagtcggcaacaccaccgat
accgcacacgaaggtggatggaccgtcgaattcgatctcgacggcgacatcaccaacctg
tggaacggcaccatcgcaagtcacaaaggcgatcattacgtgattaccaacgcttcgtgg
aacggcacaatctgggcgaaaaaaaatgcgacgctcggatttaccatgtccaagtcgctg
ttcgccgacgcccagccgacgaacttgaccgtgcgatag

DBGET integrated database retrieval system