KEGG   Bifidobacterium thermophilum: D805_0868Help
Entry
D805_0868         CDS       T02505                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
btp  Bifidobacterium thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D805_0868
Enzymes [BR:btp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     D805_0868
Exosome [BR:btp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D805_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1073869..1076073)
Genome map
AA seq 734 aa AA seqDB search
MDAVSNASYYNPHEVLGGHFAQDDERTVTVRVLRPLASSVDIITEEGGKRVRHVAEHEHN
GIFRATVPAIETHDGWGVPDYRVATTYENGETLVEDDPYRYLPTVGDLDMYLFGEGRHER
LWEALGARVMRYDDPMGSNDGTSGEQLVGTAFSVWAPNAHAVRVVGNFNGWDGRKHAMRE
LGSSGIWELFIPGVQAGEIYKYQILNANNEWVMKADPMERSHEIPPATGSIVVESHFDWD
DTAWMDHRKRTNPHDGPVSIYEVHAGSWKKGIKNYRELADQLVDYVAKEGFTHVEFMPLA
EHPFAGSWGYQVTGYYAIDSRLGGPDDFKYLVEKFHEAGIGVIMDWVPAHFPKDAFALGR
FDGTPLYEDPDPTRGEHPDWGTYIFNFGRNEVRNFLVANACFWLDEYHIDALRVDAVSSM
LYLDYSRKPGQWHPNIYGGRENLEAIDFLKEANATAYKNNPGIMMIAEESTAYPGITAPT
DQGGIGFGLKWNMGWMHDTLQYLHEQPINRKWHHNEITFSMVYAYSEHYVLPISHDEVVY
GKGSLFGKMPGDDWQRYAGVRALFAYQWAHPGKKLSFMGNEIAQYGEWDHNGSVDWDALN
WKEHRQIQHLVADLNAMYKAHPALWSQDFDPAGFQWLTSDDADHNTLSFVRIGDKGEQLV
VVVNFSGEAWEDYQVPLTSGGRWREILTTDDEQYGGSGIHNGEFEADAGAYHSRDWSAKL
TIPALGAVFLEPEN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
ttggacgccgtcagcaacgcaagctattacaacccccatgaggtgcttggcgggcatttc
gcacaggatgacgagcgcaccgtgaccgtgcgggtcctgcgtccgctggcatccagcgtc
gatatcatcaccgaggagggcggcaagcgggtccgtcatgtcgccgagcatgagcacaac
ggcatcttccgcgcgaccgtccctgcaatcgaaacgcatgacggctggggtgtgccggac
taccgtgtggccaccacctatgagaacggcgagaccctcgttgaggacgacccataccgg
tatctgccgactgtgggcgaccttgacatgtacctgttcggcgaaggaaggcatgagcgg
ctgtgggaagcgctcggtgcgcgcgtcatgcgttatgacgacccgatgggttccaacgac
ggcaccagtggcgaacagctggtcggcaccgcgttcagcgtgtgggcaccgaacgcccac
gccgtgcgcgtcgtcggcaacttcaacggctgggacggtcgcaagcacgccatgcgcgaa
ctgggttcctccggcatctgggaactgttcatccccggcgtacaggcaggcgagatctac
aagtatcagattctcaatgcgaataacgaatgggtgatgaaggccgacccgatggagcgc
tctcacgagattccgccagccactggatcgattgtggtcgaatcgcatttcgattgggac
gacacggcatggatggaccatcgcaagcgcaccaatccgcatgacggcccagtcagtatc
tacgaagttcacgccggcagctggaagaaaggcatcaagaactaccgcgaactcgccgac
cagctcgtcgactatgtcgccaaggaaggcttcactcacgttgagttcatgccgcttgcc
gagcacccgttcgccggctcgtggggctatcaggtgaccggatactacgccatcgattcc
cgtctcggcgggccggacgatttcaagtatttggtcgagaaattccatgaggccggcatc
ggcgtcatcatggattgggttccggcgcacttccccaaggacgccttcgctctcggtcgc
ttcgatggcacaccgctgtatgaggatccagatcccacccgcggcgaacacccggactgg
ggcacgtacatcttcaacttcggccgcaacgaggtgcgcaacttcctcgtcgccaacgcc
tgcttctggctggatgagtaccatatcgacgcgctacgtgtcgacgcggtctcctcgatg
ctctacctcgactacagccgcaagcccggccagtggcatcccaatatctacggcgggcgc
gagaacctcgaagccatcgacttcctcaaggaagccaatgccacggcgtacaagaacaac
cctggcatcatgatgatcgctgaggagtccaccgcgtatccgggcatcaccgccccgacg
gaccaaggcggcatcggattcggcctcaagtggaatatgggctggatgcacgacacgctg
caatatctgcacgagcagcccatcaaccgcaagtggcatcacaacgagatcacgttctca
atggtctacgcctattcggagcattacgtcctgccgatcagccatgacgaggtcgtgtac
ggcaaggggtcgctgttcggcaagatgccgggcgacgactggcagcgatacgccggcgtg
cgggcactgttcgcctatcagtgggcccacccgggcaagaagctgtcgttcatgggcaac
gaaatcgcccaatacggcgaatgggaccacaacggatcggttgactgggatgcgctcaac
tggaaggaacatcgccaaatccagcatctggtcgccgatttgaacgccatgtacaaggcg
catccggcgctatggagccaggacttcgatcccgccggcttccagtggctgaccagcgat
gacgccgatcacaacacgctgagcttcgtgaggatcggcgacaagggcgaacagctcgtc
gtcgttgtcaacttctctggcgaagcgtgggaggactaccaggtgccgctgacgagcggc
ggtcgctggcgcgaaatcctgaccaccgatgacgagcagtacggcggttccggcatccac
aacggcgaattcgaggccgacgcaggagcctatcattcccgcgattggtcggcgaaactc
accattccggcgttgggagcggtattcttggaaccagagaactga

DBGET integrated database retrieval system