KEGG   Bifidobacterium thermophilum: D805_1071Help
Entry
D805_1071         CDS       T02505                                 

Definition
bifunctional HTH-domain containing protein/aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
btp  Bifidobacterium thermophilum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    D805_1071
   01230 Biosynthesis of amino acids
    D805_1071
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D805_1071
   00290 Valine, leucine and isoleucine biosynthesis
    D805_1071
Enzymes [BR:btp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D805_1071
    2.6.1.66  valine---pyruvate transaminase
     D805_1071
Amino acid related enzymes [BR:btp01007]
 Aminotransferase (transaminase)
  Class I
   D805_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1323451..1324665)
Genome map
AA seq 404 aa AA seqDB search
MRHFGKSSKLDNVLYDVRGPVVDEAARMEASGTHVLKLNIGNPAPFGFRTPDEVVYDMAQ
QLTDCEGYSDSKGLFSARKAIMQYAQLKNIPNVSIDGIYTGNGVSELINLSMSALLDNGD
EVLVPSPDYPLWTACVTLAGGTAVHYVCDEQSEWYPDIEDMRRKITDRTKAIVIINPNNP
TGALYPPEVLQQIVELAREHQLMIFSDEIYDRLVMDGLKHVSIASMAPDLFCVTFSGLSK
SHMIAGYRVGWMVLSGNKEIAKDYIEGLNMLTNMRICSNVPAQSIIQTALGGHQSVNDYI
VPGGRIYEQREYIYEALNSIPGVSAVKPKAAFYIFPKLDVKRFGIKDDEKFALDLLREQK
LLIVQGSGFNWQQPDHFRVVYLPRIEVLKDATAKLRNFLATYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatttcggcaagtcatcgaagcttgataacgtgctttatgatgtcagaggacct
gttgtcgacgaagcggcgcgaatggaagcctccgggacccatgtcctcaagctcaatatc
ggcaatccggcgccgttcggcttccgcacgcctgatgaagtcgtatacgacatggcgcag
caactgaccgattgcgaaggctattccgattcgaaaggcctgttctcagcccgcaaggcg
atcatgcaatacgcgcagctcaagaatatcccgaatgtcagcatcgacgggatttacacc
ggcaacggtgtgagtgagctgatcaatctgagcatgtcggcgttgcttgacaacggtgat
gaggtgctggtgccttcgcctgattatccgttgtggacggcgtgcgtcacgctggcgggc
ggtacggccgtgcattacgtgtgtgacgagcagtcggaatggtatcccgatatcgaggat
atgcggcgcaagatcaccgaccgtacgaaagcgattgtcatcatcaacccgaacaatccg
actggcgcgttgtacccgccggaagtgctgcagcagatcgttgaactcgcccgtgagcat
cagctcatgatattctccgacgaaatctacgaccgcttggtgatggacggtctcaagcac
gtctccatcgcgtccatggcgcctgacctgttctgcgtcaccttctcaggactgtcgaaa
tcacacatgattgccggataccgcgtcggctggatggtgctcagcggcaacaaggagatt
gcgaaggactacatcgagggattgaacatgctgacgaacatgcgcatctgctcgaatgtc
cctgcacagtccatcatccagaccgcgctcggcggccatcagagcgtcaacgactatatc
gttccgggcggcaggatttacgagcagcgcgaatacatctatgaggcattgaactcgatt
ccgggcgtgtcggcggtcaagccgaaagccgcgttctacatcttcccgaagctggatgtc
aaacgcttcggtatcaaggacgacgagaagttcgcgctggatttgttgcgcgagcagaag
ctcctcatcgtgcagggcagtggtttcaattggcagcagcccgatcatttccgtgtggtc
tatttgccgagaatcgaagtgctcaaggacgccaccgccaaactgcgcaatttcctggcc
acctatcatcaataa

DBGET integrated database retrieval system