KEGG   Bifidobacterium thermophilum: D805_1459Help
Entry
D805_1459         CDS       T02505                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
btp  Bifidobacterium thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:btp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1786127..1788292)
Genome map
AA seq 721 aa AA seqDB search
MTEKTENDERLARPLIRLAKLVGIGTSYVGQSNDYHEIEDDVLVAVLAALGVDASNDEAI
ERSIRTILDERHARLVPPTVLHTVGKEDSVLVNTGILEIPSATITLEDGRQYDGELVAGA
GDGSQAYSLDGKFVATASLTLPKDLPIGYHTLHVRVGDREQDATLISAPEKIELIDPMKN
NQLWGWMAQLYSIRSNGSWGVGDFEDLKTLLVEAKRKTGADFMLINPVHGSEPVAPLTPS
PYLPISRRFVNFTYIRPESIPEYKQLDDAARKQIEELHSQVEPLNGDAQLIDRDTMWRMK
MRALWLVFKAGRSAGRQAEFDVYKKEQGAELESYATWCLCYDKWGKPEDTPDNWERKYAK
DSAQVAALRNQFPDTLEFYRWLEWIAGEQLESAQRAAKDAGMKIGLMADMAVGVHPAGSD
VWWNPERFAKGATVGAPPDYFNQQGQDWSQPPLNPIQLENTGYQVYREMVHGMFARAGAV
RIDHILGLFRLWWIPQGKGAKHGAYVYYDSEVMLGILAIEAARANGVVVGEDLGVVPDFV
TKSLGRHGVLGCAVEWFEQMDGKFKAPKTWREYALASVNTHDMPPSYGYLEYEQVKIREK
LNLLDCPVEEFQASATKEHNAMLKMLVDNGYLDAELLKDEKANEQQIVEALYRGLKDAPS
KLIAASITDAVGEKRAQNQPGTNNEYPNWRIPLADYDGNVVPLEKLFDNERLKSLTKIMN
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaagaccgaaaacgatgagcgcctcgctcgtcctctgattcgtcttgccaag
ctcgtcggcatcggcaccagctatgtcggccaaagcaacgactaccacgaaatcgaggac
gacgtcctcgtggcggtactcgcggcgcttggcgtggatgcgtcgaacgatgaggccatc
gaacgttccatccgcaccattctcgacgaacgccacgcgcgtctggtcccaccgaccgtc
ctgcatacggtcggcaaggaggactccgtgctggtcaataccggcattctggagattccg
tcggcgaccatcaccttggaagacggccggcagtatgacggcgagctcgtcgccggggca
ggagacggctctcaggcgtattcgttggacggcaagttcgtcgcgaccgcctcgctgacc
ctgccgaaggatcttccgatcggctaccacacgctgcatgtccgtgttggcgaccgcgag
caggacgccacactgatcagcgctccggagaagatcgagctgatcgacccgatgaagaac
aaccagctgtggggctggatggctcagctgtattcgattcgttccaacggttcgtggggt
gtcggtgatttcgaggatctcaagaccctcctcgtggaagccaagcgcaagaccggtgcc
gatttcatgctcatcaacccggtccacggcagtgagccggtggctccgctgaccccgtcc
ccgtatctgccgatcagccgtcgtttcgtgaacttcacgtacattcgcccggagtccatt
ccggaatacaagcagcttgatgacgccgcgcgcaagcagatcgaggagctgcattcccag
gtcgaaccgctcaacggcgacgcgcagctcatcgaccgcgacaccatgtggcgtatgaag
atgcgcgcgctgtggctggtgttcaaggctggacgctccgccggccgccaggctgaattc
gacgtgtacaagaaggagcagggcgccgagctcgaatcctatgccacgtggtgcctgtgc
tacgacaagtggggcaagcccgaagacacgccggacaactgggagcgcaagtacgccaag
gattccgcgcaggtcgcggcgctgcgcaaccagttccccgacacgcttgagttctatcgt
tggctcgaatggattgccggcgagcagctcgaatccgcccagcgtgcggcgaaggacgcc
ggcatgaagatcggtctgatggccgatatggctgttggcgttcatcctgccggatccgac
gtgtggtggaatcctgagcgtttcgccaagggcgccacggtcggcgcgccgccggattac
ttcaaccagcagggtcaggactggagccagcctccgctcaacccaatccagctggaaaac
accggatatcaggtgtaccgcgagatggtgcacggcatgttcgcccgcgcgggtgccgtc
cgcatcgaccatatcctgggcctgttccgcctgtggtggatcccgcagggcaagggcgcc
aagcacggcgcctacgtgtactacgattccgaggttatgctcggcattctcgccattgaa
gcggcgcgcgccaacggcgtggtcgtcggcgaagatctcggcgtggtccccgatttcgtg
acgaagtcgctcggacgtcacggcgtgcttggctgcgccgtcgaatggttcgaacagatg
gacggcaagttcaaggccccgaagacttggcgcgagtatgcacttgcttcggttaacacc
cacgacatgccaccgtcttacggctacctcgagtatgagcaggtgaaaatccgcgagaag
ctcaacttgctggactgcccggtcgaggaattccaggcatccgcaaccaaggagcacaac
gcgatgctcaagatgctcgtcgacaacggctatcttgacgcggaactgctcaaggacgag
aaggccaatgagcagcagatcgttgaggcgctgtaccgcggtctcaaggatgcgccgagc
aaactcatcgcggcatccatcaccgacgccgtcggtgagaaacgcgcgcagaaccagccg
ggcaccaacaacgagtacccgaactggcgtatcccgctcgcagattatgacggcaacgtc
gttccgctcgagaagctcttcgacaatgagcgcctgaagtcgctgacgaagatcatgaat
tcctga

DBGET integrated database retrieval system