KEGG   Bifidobacterium thermophilum: D805_1530Help
Entry
D805_1530         CDS       T02505                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
btp  Bifidobacterium thermophilum
Pathway
btp00330  Arginine and proline metabolism
btp00332  Carbapenem biosynthesis
btp01100  Metabolic pathways
btp01130  Biosynthesis of antibiotics
btp01230  Biosynthesis of amino acids
Module
btp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D805_1530
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    D805_1530
Enzymes [BR:btp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D805_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGH41797
UniProt: M4RTG6
Position
complement(1880356..1881489)
Genome map
AA seq 377 aa AA seqDB search
MAQPTHERVRRSIAQAQTIVVKVGSSSLTKPSGHLDPAKLDALVAALACARLQGARIVLV
SSGAIAAGFGPLGFERRPADIATQQACASVGQGLLMARYEVSFSRFGIRVGQILITAEDT
IRATQYHNAQRTLDRLLDLGVVPVVNENDALANNEIRFGDNDRLSALVANIVRADALVLL
TDVDALYTAPPSQPGSKKIDFVPDVERALNEVKVAGSSSGVGTGGMVTKLEAAHMAAVSG
IPAVLTCAANAGPALMGDPVGTAFAPIKRRGSSRRLWIKFASHPRGVLVVDTGAAQAVRA
GRASLLSAGVLEVRGDFSAGDPIWIDDESGKHIAKGLSGYDSEEIPRMLGRNTAQLRRFF
GDEYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcccacgcatgagagagtcagacggtccatcgcgcaagcgcagacgattgtg
gtcaaggtcggttccagctcgctgaccaagccttcggggcatcttgacccggcgaaactg
gacgcgctggtcgcggcactcgcatgcgcgcggttgcaaggggcgcgcatcgtcctcgtg
tcatcgggcgctatcgctgccggattcgggccgcttggcttcgaacgccggccggccgat
atcgcaacgcagcaggcgtgcgcatccgtcggccagggactgctcatggcccggtatgag
gtgtcgttcagccgtttcggcatccgggtcggccaaatcctcatcaccgcggaggacacg
atcagggcgacgcaataccacaacgcgcagcgcaccttggatcgtctgcttgatttgggc
gtcgtgccggtcgtcaacgagaacgatgccctggcgaataacgaaatccggttcggtgac
aacgaccgcctgtccgcgctggtggcgaatatcgtgcgcgcggacgccctcgtgctgctc
actgacgtggacgccttgtataccgcgcccccgagccaacccggttcgaagaaaatcgac
ttcgtacccgatgttgagcgcgcgctcaatgaggtcaaagtcgcgggcagctcctctggc
gtcggtaccggaggcatggtcaccaagttagaagccgcccatatggccgcggtctcgggc
attcctgcggtgctcacctgtgctgcgaatgcagggccggccttgatgggcgacccggtg
ggtacggcgttcgcgcccatcaagcggcgtggttcgtcgaggcggctgtggattaaattc
gcgtcgcatccgcgtggcgtgcttgtcgtggacacgggagccgcacaagccgtgcgtgcc
ggccgtgcgagcctgctgagcgccggcgttctcgaggtgcgtggcgatttttccgcaggc
gacccgatctggattgacgacgagtccggcaagcatattgccaaggggctctccggctac
gattccgaggaaatcccgcgcatgctggggcgcaacaccgcgcagctgcggcgtttcttc
ggcgacgaatacgcgcatccgcttgtgcatcgcgataatctcgttcttgtgtaa

DBGET integrated database retrieval system