KEGG   Bifidobacterium thermophilum: D805_1682Help
Entry
D805_1682         CDS       T02505                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btp  Bifidobacterium thermophilum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D805_1682
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    D805_1682
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    D805_1682
Enzymes [BR:btp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     D805_1682
Exosome [BR:btp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D805_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2076145..2078193)
Genome map
AA seq 682 aa AA seqDB search
MKRHAIITGAVAAVTAIATAAALPTLALAQDGKSAEQLAQHGAAQRIATVGAANAKNVIL
FIGDGMGDSEITVARDYLKGANGSFDGLDKIGQPNLSGAKENGTGQYTTFSLGGSSKDAG
KPVVTPVTDSAASGSGWATGTKTYNNAVSVDSSQNPQLNLIELAKAKGLATGNVTTAEIQ
DATPAVLESHSTQRSCYGPQGKTDGSSDDSAKRCDVAQLKQNGGIGSISEQLLDTRADVT
IGGGSKYFNQTAQAGEYAGKTLWEQAKERGYQTVENDVNAFSALSYKENQPVLALLGDGN
LPTQFNDTPALTQKLTEQRGAIQCSTNPSWLGNKNAAGNSASLADMTDKAIDLLQANPKS
SSNGFFLQVEGASIDKQDHAANACGQIGETDDLDKAISAALKKVDLSNTLIIVTADHAHT
SQIVGEPPAYALSTILKSPVDGAQIVVSYGTATVTDPDAEDASRGYNDGGMEHTGTQLRI
AASGPGAFRVDGLTDQTDNFYTIAKSLGLAADTDAQNALSSNAKVSVKDGVAKVAGFNGD
AVLGYQLQDTETGAVLASSNDDTPVSGVRVATGETTTIDFNGVKGFDPSASTYTLTVTGK
QSGTKIATEFGLTGNGASNVVIAPKTGDKAGNKAQQAGLGGALVGALGQTGTRILGTVMM
VLALAVAGGLLAAWRRGIFARK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgacatgcaatcatcaccggggctgtggcggccgtcaccgccatcgccacggca
gcggctctgccaacacttgcccttgcacaagacggaaagagcgctgaacaacttgcgcag
catggcgccgcgcagcgcatcgcgaccgtaggcgccgccaatgcgaagaatgtaatcctg
ttcatcggcgacggcatgggtgattcggaaatcaccgtcgcccgagactacctcaagggt
gccaacgggtccttcgacggactcgacaagattggccagcccaacctgtcgggcgccaag
gagaacggcactggccagtacaccaccttctctctcggtggcagcagcaaggatgcgggt
aagcctgtggtcacgccggtgaccgattccgccgcatcaggttctggctgggcgaccggc
accaagacctacaacaacgcagtatccgtggattcctcgcagaacccgcagctcaacctc
atcgagctggccaaagccaagggattggcgaccggtaatgtgaccaccgcggaaatccag
gacgccaccccggcagtgctggaatcccactccacccagcgctcctgctacggtccgcaa
ggcaagaccgacggcagctcagacgattccgccaagcgctgcgatgtcgcccagctcaag
cagaacggcggcatcggttccatttccgagcagttgctcgacacgcgggctgacgtaacc
atcggcggcggctccaagtacttcaaccagaccgctcaggccggtgaatacgcgggcaag
acgctgtgggaacaggccaaagagcgcggttaccagactgtcgaaaacgatgtgaacgcg
ttctcggctctctcctacaaggagaaccagccggttctcgctcttctgggcgacggcaac
ctgcctacccaattcaatgacacgccggcgctgacccagaagctcactgagcagcgtggc
gccatccagtgctccacgaatccgagctggttgggcaacaagaacgctgccggtaactcc
gcatcgcttgctgacatgacggacaaggcgatcgatctgctccaagccaacccgaagagc
tcgagcaacggcttcttcctgcaagtcgaaggcgcgtccatcgacaagcaggatcacgcc
gccaacgcttgcggccaaatcggcgaaaccgacgacctcgacaaggcgatctccgctgcg
ctgaagaaggtcgatctgtccaacaccttgatcatcgtcaccgctgaccacgcgcatacg
agccagatcgtcggcgagccgccggcctacgcgctcagcaccatcctcaagtctccggtt
gatggcgcccagatcgtcgtgtcttacggcaccgcgaccgtcaccgatccggatgcggag
gacgcttccaggggatacaacgacggtggcatggagcacaccggcacccagctgcgcatc
gcggcttccggccccggcgcatttcgtgtcgacggcttgacggatcagaccgacaatttc
tacaccatcgccaaatcccttggactcgcggccgatactgacgcgcagaacgcgctgtcc
tccaacgccaaggtttccgtcaaggacggcgtggcgaaggtcgccgggttcaacggcgac
gcagtgctcggctaccagctgcaagacacggaaaccggtgccgtgctcgcttcatcgaac
gatgacaccccggtctccggagtgcgcgtcgccaccggtgagaccacgaccatcgacttc
aacggtgtcaagggcttcgacccgagcgcatcgacctacacgctgaccgtcaccggcaag
cagtccggcacgaagatcgcgaccgagttcggtctcaccggcaacggtgcaagcaacgtc
gtgattgcgccgaagactggtgacaaggctggtaacaaggcccagcaagccgggttgggc
ggcgccttggtgggtgccctcggccaaaccggtacccgcatcctcggcacggtgatgatg
gtgcttgcgctcgccgtcgccggtggtttgctcgccgcatggcgccgcggcatattcgct
cggaagtaa

DBGET integrated database retrieval system