KEGG   Bifidobacterium thermophilum: D805_1815Help
Entry
D805_1815         CDS       T02505                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
btp  Bifidobacterium thermophilum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:btp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    D805_1815
  Lipid metabolism
   00561 Glycerolipid metabolism
    D805_1815
   00600 Sphingolipid metabolism
    D805_1815
Enzymes [BR:btp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     D805_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2247508..2249721
Genome map
AA seq 737 aa AA seqDB search
MTRITIIPGTANDGTDLTAVYAENAAANVAFALIFPGKALPRFVHWGRPLTHPETLVHLY
DALKPQRVSGALDNTAWPSILPTQSESWIGAQRIDIRRDGRELFCNFAVTAISPAAGDNE
GASIISVDAQDADQQIALQWTCELTDSGLIRQSATITNLGDGTLDVNGVELGYPMPQQAV
EILTTTGHHLRERSPQRQPLTVGRFEKLSMAGRPDFDASLLLTAGAPGFGFEHGDVYSVH
VGWSGNSVLSAERLPYTQGVIGGGEKLFGGEITLEHGGQYTTPWVYGAFGTGLNEVAHRF
HGFLRAQHPNLANKPRPVILNTWEAVYFQHDYDTLVRLADKAVDSGVERFVVDDGWFGAR
RDDTAGLGDWQVSQDVWPDGAKSLKALADYVHSKGMEFGLWFEPEMVNPNSNMFRNHPDW
VLRPAPGRLPMQGRSQQVVDLTNPDAYDYVFCAMDHLVGELGIDYIKWDHNKLVTEAVSP
RSGKPAVHEQTLAVYRIYRDLKLAHPGLEIESCSSGGGRIDLGILRYADRVWASDCVDPV
ERADIQRYTSLLVPPEMIGEHVGASPAHSTHRATSQDLRMDMAFFGHMGIEWNLLKEPQE
DLDKLAAWVRAYKEHRAMFETGTAVHADTTDPAVRLDGMVSADRSYAVYRFTQLTTSQTY
PAAPVDLPGLDPEAVYQVKPLPASLNLDDEGIGNGQSALGWWTADGVTLPAVALETYGLR
PPSLHPAQAVLFEAVRV
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatcaccatcatccccggaacagcgaacgacggcactgacctgactgcggtg
tacgcggagaacgccgctgccaacgtagcgttcgcactgattttcccgggcaaggccctc
ccccggttcgtccattgggggcgcccgctgacgcatccggaaaccctcgtgcacctgtat
gacgcgctcaaaccgcaacgcgtgtccggcgcattggacaacaccgcatggccgagcatt
ctgcccacgcagtctgaatcgtggatcggcgcgcaacgcatcgatatccgccgtgacggg
cgcgagctgttctgcaacttcgccgtcaccgctatcagccctgccgcaggagacaacgag
ggtgcctccatcatcagcgtcgacgcacaggacgccgaccagcagatcgctctgcagtgg
acctgcgaactgaccgattccggcctgatccgccaatctgccaccatcaccaatctcggc
gacggcaccttggacgtcaacggtgttgaactcgggtatccgatgcctcaacaggcggtg
gaaatcctcaccaccaccggccaccatctgcgtgagcgctcaccgcagcgccaaccgctc
accgtcggccgcttcgaaaagctttcaatggccgggcgccctgatttcgacgcatccctg
cttctgaccgccggcgcccccggattcggcttcgagcacggcgacgtgtattccgtgcat
gtgggttggagcggcaacagcgtgctgtctgcagaacgtctgccctacacgcagggtgtg
atcggcggcggcgagaagctgttcggcggcgaaatcacactggagcatggaggccagtac
accacgccgtgggtgtatggcgcgttcggcaccgggctgaacgaggtcgcccaccgcttc
cacgggttcctgcgcgcgcagcacccgaatctcgccaataagccgcgtccggtcatcctc
aacacgtgggaggccgtctatttccagcatgattatgacacgctcgtccggctcgcggac
aaggccgtggacagcggtgtggagcggttcgtcgtggatgacggctggttcggcgcccgg
cgcgatgacaccgccggcctcggcgactggcaggtctcacaggatgtgtggcccgacggc
gcaaaaagcctcaaggcgttggccgactacgtgcacagcaagggcatggagttcggcctg
tggttcgagccggagatggtcaatccgaactcaaacatgttccgcaaccacccggattgg
gtactgcgccccgcccccggccgcctgccgatgcaggggcgttcccagcaggtcgtcgat
ctgaccaatccggacgcgtacgattacgtgttctgcgcgatggaccatctggtcggcgaa
ctgggcatcgactacatcaagtgggatcacaacaagctcgtcaccgaagcggtgtccccg
cgctccggcaagccagccgtgcacgaacagacgctcgccgtataccgaatctaccgtgat
ctgaaactcgcgcatcccggactcgaaatcgaaagctgttcctccggcggcggccgtatc
gatctgggcatcctgcgctacgccgaccgtgtctgggcatccgactgcgtggatccggtg
gagcgtgcagacatccagcgctacacgtcattgttggtgccgcccgaaatgatcggtgag
catgtaggcgccagccccgcacattcgacgcatcgcgcgaccagccaagacctgcgtatg
gatatggcgttcttcgggcatatgggcatcgaatggaatctgctcaaggagccgcaggag
gatctggacaaactggccgcatgggtgcgcgcgtacaaggagcaccgcgccatgttcgaa
accggaacggcagtgcatgcggataccacagaccccgcggtgcgcttggacggcatggtc
agcgccgaccgctcgtacgccgtctaccggttcacccaactgaccacatcgcagacctac
cctgcggcgccggtcgaccttcccggtcttgaccccgaagccgtgtaccaggtcaagccg
ttgccggcaagcctgaaccttgacgatgaaggcatcggcaacgggcaatcagcgctcggt
tggtggacagccgacggcgtgaccctgccggccgtcgcgctcgaaacctacggtctacgt
ccgccaagcctgcacccagcgcaagccgtgctgttcgaagccgtacgcgtgtga

DBGET integrated database retrieval system