KEGG   Burkholderia thailandensis 2002721723: BTQ_3573Help
Entry
BTQ_3573          CDS       T03111                                 

Definition
(GenBank) fatty acid desaturase family protein
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BTQ_3573
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BTQ_3573
Enzymes [BR:btq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BTQ_3573
Lipid biosynthesis proteins [BR:btq01004]
 Desaturase
  First
   BTQ_3573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
2:complement(376498..377538)
Genome map
AA seq 346 aa AA seqDB search
MKHASAESPESTGCAETPARAPAGSAADTAAPPAPDGRASGHLSRASSARHLGVAALPAA
GTAAAIALWAGFGLAPRAQDIAMLAVFYVLNILGMELALHRYFAHRTFKAKPPVKIALAI
LGSLAYMGPLMWWVAIHRLHHANADRPGDPHTPQLGGRGFVGRAKGILHGHVGWLFDPSS
ARPKGWNQYANDMYRDPALLRIHLAYDYWLLLGLLLPAAIGWLLDPSWRGALLGLLWGGT
VRIFLATNAIWAVNSIGHALGGRRPFPGRDQSRNAAWLALVTLGAGWHNNHHAFPQYAST
RLTRWQIDVTGMLIALLERLGLVWDVQHPDRDAVRERLANARRDDA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcgagcgccgagagccccgagagcaccggctgcgccgaaacgccggcacgc
gcgccggccggctcggcggcggatacggccgccccgcccgcgcccgacgggcgcgcgtcc
ggccatctgtcgcgcgcgtcgtccgcgcgccatctgggcgtcgcggcgctccccgccgcc
ggcacggccgccgcgatcgcgctctgggcgggattcggcctcgcgccccgcgcgcaggac
atcgcgatgctcgcggtcttctacgtgctcaacatcctcggcatggagctcgcgctgcac
cgctatttcgcgcatcgcacgttcaaggctaagccgcccgtgaagatcgcgctcgcgatc
ctcggctcgctcgcgtacatggggccgctgatgtggtgggtggcgatccaccgcctgcat
cacgcgaacgccgaccggccgggcgacccgcacacgccgcaactcggcgggcgcggcttc
gtcggccgcgcgaagggcatcctgcacgggcacgtcggctggctgttcgatccttcgtcc
gcgcgcccgaagggctggaaccaatatgcgaacgacatgtaccgcgacccggcgctgctg
cgcatccatctcgcgtacgactactggctgctgctcggcctgctgctgccggccgcgatc
ggctggctgctcgatccttcgtggcggggcgcgctgctcggcctgctgtggggcggcacc
gtgcggatctttctcgcgaccaacgcgatctgggcggtcaattcgatcggccacgcgctc
ggcggccggcggccgtttcccggccgcgaccagagccgcaacgcggcgtggctcgcgctc
gtcacgctcggcgcgggctggcacaacaaccatcacgcgtttccgcagtatgcgagcacg
cgcctgacccgctggcagatcgacgtgaccggcatgctgatcgcgctgctcgaacggctg
gggctcgtgtgggacgttcagcacccggaccgggacgcggttcgcgaacggctcgcgaac
gcgcggcgcgacgacgcgtag

DBGET integrated database retrieval system