KEGG   Burkholderia thailandensis 2002721723: BTQ_795Help
Entry
BTQ_795           CDS       T03111                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BTQ_795
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BTQ_795
Enzymes [BR:btq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BTQ_795
Lipid biosynthesis proteins [BR:btq01004]
 Desaturase
  First
   BTQ_795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:914081..915277
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSNGLLRFSWWQVVLFTLAVTHVTIVGVTVYLHRCQAHRALDLHPVMSHFFR
LWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRAEAKNEETM
RKYGHGTPNDWLERNLYSKYPILGVSLMMVIDVALFGVVGLTVWAVQMVWIPFWAAGVVN
GLGHFWGYRNFNAADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKIAPTPRLAARKTVLDQETLQAVLSNRYEVMARYAKTLKRAYRQELVHL
KELGAREKYQLMRGARKWFHKEEAGLDEPQKRMLPEIFANSQKLHTFFQLRTELAAIWER
SNASRDQLLAQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgatttcctttccaacgggcttctgcgtttctcgtggtggcag
gtcgtgctgttcacgctcgccgtcacgcacgtgacgatcgtcggcgtgacggtctatttg
catcgctgccaggcgcaccgcgcgctcgatctgcatccggtcatgagccacttcttccgc
ctgtggttgtggatgacgacgggcatgctgacgggccagtgggcggcgatccatcgcaag
caccatgcgaagtgcgagaccgaggaggacccgcacagcccgcagacgcgcggcatctgg
aaggtgctgctcgaaggcgccgaactgtatcgcgcggaggcgaagaacgaagagacgatg
cgcaagtacggccacggcacgccgaacgactggctcgagcgcaatctctactcgaagtat
ccgattctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcgtggtcggc
ctcaccgtgtgggcggtccagatggtgtggattccgttctgggcggcgggcgtcgtcaac
ggcctcggccacttctggggctatcgcaacttcaatgcggccgacgcgagcacgaacctg
ttcccgtggggcatcgtgatcggcggcgaggaactgcacaacaaccatcatacgtttgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggcgttcgggctcgcgaaggtgaagaagatcgcgccgacgccgcgcctcgcc
gcgcgcaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgctacgag
gtgatggcgcgctacgcgaagacgctcaagcgcgcgtacaggcaggagctcgtgcacctg
aaggaactgggcgcgcgcgagaagtatcagctgatgcgcggcgcgcgcaagtggttccac
aaggaagaggcgggcctcgacgagccgcagaagcggatgctgccggagatcttcgcgaac
agtcagaaactgcatacgttcttccagctgcgcacggaactcgccgcgatctgggagcgc
tcgaacgcgtcgcgcgaccagttgctcgcgcagctgcaggattggtgccatcgcgccgag
caaagcggcatcaaggcgctgcaagagttcgcgacgcgtctgcgccgctacgcctga

DBGET integrated database retrieval system