KEGG   Bartonella tribocorum CIP 105476: BT_0075Help
Entry
BT_0075           CDS       T00636                                 

Gene name
dapD
Definition
(GenBank) 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succinyltransferase
  KO
K00674  
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
btr  Bartonella tribocorum CIP 105476
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BT_0075 (dapD)
Enzymes [BR:btr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     BT_0075 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(95085..95945)
Genome map
AA seq 286 aa AA seqDB search
MTHLTQLEIIIEKAFDDRDSINTTTKGEIRESVEHTLSLLDKGEIRVAERQKNGQWYVHQ
WLKKAVLLSFRLNPMQIITGGINGTHWWDKVPSKFSGWKEDDFQKAGFRSVPGAIVRHSA
YVAPNVILMPSFINLGAFVDEGTMVDTWTTVGSCAQIGKHVHLSGGVGIGGVLEPLQANP
TIIEDHCFIGARSEVVEGCIIREGAVLGMGVFIGQSTKIIDRTTGEIFIGEVPAYSVVVP
GSLPGKPLPNGEAGPNLYCAVIVKRVDQKTREKTSINELLRDETQC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacccatctcacacaacttgaaatcattatcgaaaaagcatttgatgatcgcgattct
attaatactaccacaaaaggtgaaattcgtgagagtgtcgaacacacattgagccttctt
gataaaggtgaaatccgtgttgcagaacggcaaaaaaatggacaatggtatgttcatcaa
tggttgaaaaaagctgttttgctctcttttcggctaaacccaatgcaaattattactggt
ggaatcaatggaacacattggtgggataaagttccctcaaaattttctggttggaaagaa
gatgattttcaaaaagcggggtttcgttctgttcctggagcgattgtacgccattctgcc
tatgttgcaccaaacgtcatactcatgccatcctttatcaatcttggcgcttttgtcgat
gagggtacaatggttgatacatggacaaccgttggttcttgcgcacaaattggtaaacat
gttcatctttctggtggtgttggaatcggaggtgttttagaaccactgcaagcaaatcca
accattattgaagatcattgttttattggtgcacgctctgaagttgttgaaggctgtatt
attcgtgaaggcgctgttttaggaatgggcgtttttattggacaatccaccaagattatc
gatcgtacaacaggagaaatttttattggtgaagtaccagcctattcggttgttgtaccg
ggttctcttcctggcaaaccactccctaatggtgaagcaggaccaaacctttattgtgct
gttattgtaaaacgcgttgatcaaaaaacacgagagaaaacatccattaatgagctttta
cgtgatgagacacaatgttaa

DBGET integrated database retrieval system