KEGG   Bartonella tribocorum: Btr_0051Help
Entry
Btr_0051          CDS       T00636                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
btr  Bartonella tribocorum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:btr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70950..72122
Genome map
AA seq 390 aa AA seqDB search
MLVLTDPLQLLQALIRCPSVTPHEAGALSALEQFLKKMGFHVERPIFTDKNTDNVENLYA
KMGNEGPHLMFAGHTDVVPPGALEDWTYPPFEAVIDQGKLYGRGAVDMKGGIACFIAALA
RVLEKRSIKGRVSLLITGDEEGTAINGTVKLLKWAEKKGEKWTAALVGEPTSVKTVGDII
KIGRRGSISGIITVKGRQGHVAFPERAANPLPLASKLIQALTQIALDQGTENFQPSNLEL
TTIDTGNLAVNVIPAQTTVRFNIRYNDLWTKETLMEEIEKRLSLVQEKNNSGQYPFYQLE
WIPSLGDVFLTKNDKLIQVLSNAIKSVTGSLPECSTSGGTSDARFIKDYCPVVEFGLPGQ
TMHMVDECVALDAVETLTAIYERFIIDFFV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttcttacagatccgcttcagctattgcaggcacttatccgttgtccttctgtt
acacctcatgaagcaggggctttatcagctttggaacaatttttgaaaaaaatgggattt
catgtcgagcgtcctatttttacggataaaaatacagataatgttgaaaatctttatgcc
aaaatgggaaatgaaggaccccatcttatgtttgcgggtcatacggatgttgtaccgcca
ggtgcattggaagactggacttatccgccttttgaagctgttatagatcagggaaaatta
tatgggcggggtgctgttgatatgaaaggcggaattgcttgttttattgcggctctagca
cgcgttcttgagaaacggtctattaaaggaagggtaagccttttaattactggtgatgaa
gaggggactgctattaatggtacggtaaaacttctcaaatgggcagaaaaaaaaggtgaa
aaatggactgcggcgcttgtgggagaaccaacaagcgtaaagactgttggtgatattata
aaaattggacgacgcggatcgatttctggtatcattaccgtgaaaggtcgccaaggtcat
gttgcttttccagagcgggctgccaatcctttgcctttggcgagtaagcttattcaagcg
ttgacacaaattgctttagatcaaggaacagagaattttcaacccagtaatttagagcta
acaaccatcgataccggtaatttagcggtcaatgttattccagcgcagacaacggttcgt
tttaatatacgctacaatgatctttggacaaaagaaacattgatggaggaaattgaaaag
cgtctttctttggtgcaagaaaaaaataatagtggtcaatatcccttttatcagcttgaa
tggattccaagtttaggggatgtttttttgaccaaaaatgataagctgattcaagtttta
tccaatgctattaaaagtgtaacagggagtttaccagaatgttccacgtctggtggaact
tcagatgcgcggtttattaaggattattgccccgtggttgaatttggcttaccagggcaa
acgatgcatatggtcgatgaatgtgttgcccttgatgcagtagaaacacttactgctatt
tatgagcgttttattattgatttttttgtataa

DBGET integrated database retrieval system