KEGG   Bartonella tribocorum: Btr_0193Help
Entry
Btr_0193          CDS       T00636                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btr  Bartonella tribocorum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Btr_0193 (galU)
   00052 Galactose metabolism
    Btr_0193 (galU)
   00500 Starch and sucrose metabolism
    Btr_0193 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Btr_0193 (galU)
Enzymes [BR:btr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Btr_0193 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247697..248611
Genome map
AA seq 304 aa AA seqDB search
MNSLRRVSLRKIRKAVFPVAGLGTRFLPATKTIPKEMLTVVDKPVIQYVVDEAREAGIEH
FIFVTGRNKAVIEDYFDAQVELYTTLAECGKKEDLAHLYRLQPLPGTTSFTRQQQPLGLG
HALWCARELVAGEPFALLLPDMLIQAKKGCLSEMMSLYERTGGGNIIAVQECDPRETHKY
GIVGKGKQIANGFEITEMIEKPALGTAPSNLYINGRYILQPEIFNILSTQERGTGNEIQL
TDAMIRLSNEQDFWGLQLEGRTFDCGSKAGFIEANVAFSLARADMNSHVSASLKNLLETI
TVEK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattgaggagggtgagtttgcgtaaaatccggaaagcagtatttcccgtagca
ggtcttggtacgcgttttcttcctgcgacaaaaacgataccgaaagaaatgctaacagtt
gttgataagcctgttattcaatatgttgtggatgaggcacgggaggctggtattgagcat
tttatttttgtgactgggcgcaacaaagcagtcattgaggattattttgatgcgcaagtt
gaattatatacaacacttgctgaatgtgggaaaaaagaagatcttgcgcatttataccgt
ttacagccgttgccagggacaacttctttcacacgtcaacagcaacctttggggttaggg
catgcgctttggtgtgcgcgtgaattagttgcaggcgaaccttttgctttattattacct
gatatgttgatacaagcgaaaaagggatgcctttctgagatgatgagtctttatgaaaga
acggggggtggaaatattatagcagttcaggaatgcgatcctagagaaacccataaatat
ggtattgtggggaaaggcaaacagattgccaatggttttgaaatcacagaaatgatagaa
aaaccagcgcttggaacggcaccatcaaatttgtacatcaatggacgttatattttgcag
ccagaaatttttaatattctttccactcaagaacgaggaacaggaaatgaaattcaacta
acagatgcgatgataaggctttcaaacgaacaggatttttggggtttgcaattagaaggg
cgcacttttgattgcggttctaaagctggttttattgaagctaacgttgcattttctttg
gcacgtgctgatatgaacagccatgtttctgcctcattgaaaaatttactggaaaccatt
acagttgaaaaatga

DBGET integrated database retrieval system