KEGG   Bartonella tribocorum: Btr_0256Help
Entry
Btr_0256          CDS       T00636                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
btr  Bartonella tribocorum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:btr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(316943..317548)
Genome map
AA seq 201 aa AA seqDB search
MSKYIAGPEIERLIQILARLPGLGPRSARRAALHLIKKKETLLEPLGAAVQAAIEKVGIC
SVCGNVDTIDPCSICTDSRRDDTTIIVVEDIADLWALERAKTLAARYHVLGGRLSPLDGI
GPDELNIATLIQRVVQNPITEIILAVNATVEGQTTAHYITDQLSNFPVKITRLAHGVPVG
GELDYLDDGTLAAAVQARTNL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatacattgcaggacctgagattgaacgtctcattcaaatcttagcacggttg
ccaggtcttggtccgcgttcagcacgtcgtgctgcgcttcatcttattaagaaaaaggaa
actttactggaacctttgggagcggcagtacaagccgctatagaaaaagtcggcatttgt
tctgtttgtggcaatgtcgataccattgatccttgttcaatttgtacagattcgcgacgc
gatgatacaacaatcattgttgttgaggatattgctgacctgtgggctcttgaacgcgca
aaaactttagccgcacgttatcatgtattgggtggacgactctcacctttagatggaata
ggtcctgacgagcttaacattgccaccttaatacaacgtgttgtacaaaacccaattacg
gagattattcttgctgtcaatgcgactgtcgaaggacaaacaaccgctcactacatcacc
gatcagctttccaattttccagtcaaaattacgcgacttgctcatggtgttcctgtagga
ggcgagctcgattatcttgatgatggaactttagcagcggctgtacaagcaagaacaaat
ctttaa

DBGET integrated database retrieval system