KEGG   Bartonella tribocorum: Btr_0264Help
Entry
Btr_0264          CDS       T00636                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
btr  Bartonella tribocorum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Btr_0264 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Btr_0264 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323342..323905
Genome map
AA seq 187 aa AA seqDB search
MNRWKAIYFIGACLCVLVIVVGISTLSDIVYDHSPSVQYYHTVTKNDTFKEKQKESDIPV
SLNSRLQQGDFENGRKIFRQCAICHTSGRNQAGRVGPVLWEIVDRPLASAAGFAYSRALR
AHSDQKWDFVTLDRYLRSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSDHPVPLPIDN
NKVNGPK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctggaaagctatctattttattggcgcatgtttatgtgtgctggttattgtt
gtgggaatttccacactcagcgatatagtttacgatcattctccatcagtccaatattat
cacacagttaccaagaatgatacatttaaagaaaaacagaaagaatccgatattcctgta
tcactaaatagccgccttcaacaaggcgattttgaaaatgggcgtaaaatttttcgtcaa
tgtgccatatgccatacttctggacgcaatcaagcagggcgcgttggtccagttctttgg
gaaattgttgaccgccctttggcatctgccgcaggttttgcatattcacgtgcattgcgt
gcgcattctgatcaaaaatgggattttgtaacgttagatcgttatctgcgttctccacgt
gaagcatttcctgggaccattatgtctttccgtggaattaaaaatgaccaagatcgtgcc
gatcttttgctttatttacgcagtctatcggatcatcccgttcctttaccaatcgataat
aacaaagtgaacgggccaaaataa

DBGET integrated database retrieval system