KEGG   Bartonella tribocorum: Btr_0275Help
Entry
Btr_0275          CDS       T00636                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
btr  Bartonella tribocorum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:btr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335326..336201
Genome map
AA seq 291 aa AA seqDB search
MPELPEVETVRRGLESVVTDAKIVSVQLNRRDLRFPFPEAFSERLIGRKILELGRRAKYL
LFHLSQDETILSHLGMSGSWRIENDLLRTAFSMTSKLVKHDHFIMDIQTRNGDVYHLIYN
DVRRFGFMLLVDTDKLYKHPLLNKLGLEPMSHGFSGRYLQKAFVNKKVSLKGVLLDQSIV
AGLGNIYVCEALWRSRLSPQRGAFTLASKTVYARELANSLAQNIRNVISEAILSGGSSLR
DYMHVDGSLGYFQHAFSVYGREGKECLQCGTPIIRILQSGRSSFYCSQCQK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttcctgaagtagagacggttcgtcgtggacttgagtctgttgtcactgat
gcaaagatagtatctgtccaacttaatcgtagagatttgcgttttccttttcctgaggct
ttttctgaacggcttattggaagaaaaattctggaacttggtcggcgtgcgaaatattta
ttatttcatctgtctcaagatgaaacgattttaagccatttaggaatgtctggttcatgg
cgtatagagaatgatcttttaagaacagctttttcaatgaccagtaaattggttaagcat
gatcattttatcatggatattcagacaaggaatggtgatgtttatcatcttatttataat
gatgtacgccgctttgggtttatgcttttagttgatacggacaagctttataaacatccg
cttttaaataagctagggcttgaacctatgagtcatgggttttctggtcgttatttacaa
aaggcttttgttaataaaaaagtatctcttaagggtgttttgcttgatcagtctattgtt
gcagggcttgggaatatttatgtttgtgaggcgctttggcgaagtcgcttatctccacag
cgtggtgcatttacattggcatcaaaaacggtctatgcacgtgaacttgcaaattcttta
gcacagaatatacgcaatgtgatttctgaagctattttgtctggcgggtcttctttacgt
gattatatgcatgtggatggctctcttggttattttcaacatgctttttcggtttacgga
cgagaaggcaaggaatgcttgcaatgtggaacgcctattatacgtattttacagtcggga
cgttcaagtttttactgttcacagtgccaaaaatga

DBGET integrated database retrieval system