KEGG   Bartonella tribocorum CIP 105476: Btr_0482Help
Entry
Btr_0482          CDS       T00636                                 

Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
btr  Bartonella tribocorum CIP 105476
Brite
Enzymes [BR:btr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Btr_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(525153..525815)
Genome map
AA seq 220 aa AA seqDB search
MRTISPEGLALIKQWEGLRLNAYKDAIGVWTIGYGHTNNAGKPFVHKGMTITEKQAEELL
CQDLKQFENAVERAVTVSLTDEQFAALVSFCYNVGTTAFCNSTLLKKLNNGEYEAIPIEL
QKWTKAGGKRLQGLVHRRAAEAGLWAKGAFVSSNYQTVETQAPTGLFKAEALAPVIGSFS
GLGGLLAGNGPVQWALATIMVLAAGVGLFFVAKRFQEHRL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaatatcaccagaaggactagcactgattaaacaatgggaaggcttgcgtttg
aatgcctataaagatgccattggggtatggaccattggttatggacatacaaacaatgcc
ggaaaaccttttgttcataaaggcatgacaatcactgaaaagcaagctgaagaacttctt
tgccaagacttaaaacaatttgagaatgctgttgaacgcgctgttacggtttccttaacg
gatgaacaattcgcggcattggtttccttttgctataatgtaggaacaacagcgttttgc
aattcgaccctgttaaaaaaactcaataacggtgaatatgaagcaatccctatcgaatta
cagaaatggaccaaagccggtggaaaacgcttgcaaggtcttgtacaccgacgtgcagca
gaagcaggattatgggcgaaaggtgcttttgtttcctcgaattaccaaaccgtagaaacg
caagcaccaacagggcttttcaaagccgaagcccttgcaccagtcattggttctttttct
ggacttggcggcttattagcaggcaacggtccagtgcaatgggcgctcgccactatcatg
gttttagctgcaggtgttggtcttttctttgttgctaaacgttttcaggaacaccgttta
tga

DBGET integrated database retrieval system