KEGG   Bartonella tribocorum CIP 105476: Btr_0663Help
Entry
Btr_0663          CDS       T00636                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btr  Bartonella tribocorum CIP 105476
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Btr_0663 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Btr_0663 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Btr_0663 (thrC)
Enzymes [BR:btr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Btr_0663 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(699555..700952)
Genome map
AA seq 465 aa AA seqDB search
MQYISTRGESPALSFTETIMTGLASDGGLYLPDKFPQLSFDALRALRGQSYTTIATTLLW
PFVNNEIEYTAFENMIAESYTTFHHPAICPLRQTGTDEFILELFHGPTLAFKDVAMQFLS
RLMDYVLTKKNRFATIIAATSGDTGGAAIQACAGKEHSDIFILFPKGRVSPIQQRQMTTN
QSTNVHAIAIEGNFDDCQALVKAMFNDHHFRKKRALSGVNSINWARIMAQIVYYFSSALS
LGAPDRAVSFTVPTGNFGDIFAGYVAARMGLPIAQLVIATNDNDILARTLTSGTYETQPI
VHTTSPSMDIQVSSNFERLLFESGNRDPMWIRNAMENLKKMGSFTLNEKQLKNIRSLFSA
GKSNMAETAQTIDRVYKESGYLVDPHTAVALKVARENKKPHIPMIVLATAHPAKFPDTIK
NACGLHAPWPSHLNDIMEGEEHFISLANDEKTVKDYISLKSRASY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatcagcacgagaggtgaatctcctgctttaagctttacggaaacaatcatg
acagggctggcaagtgatggtggactttatcttccagataaatttccacaattatcattt
gatgcgttacgcgcacttcgcggtcagtcttatacaacaattgctacaacacttctatgg
ccctttgtaaataacgagatcgagtacacagcttttgaaaatatgattgctgaatcttat
acaaccttccaccatccagcaatctgtccgttacgacaaactggaacagatgagtttatc
cttgaactctttcatgggcctactttagcttttaaagatgtcgcaatgcagtttctttct
cggctaatggattatgttttgactaaaaaaaatagatttgcaacgattattgccgcaaca
tcgggtgatacaggaggagctgcgatacaagcttgtgctggaaaagaacactcagatatt
tttattttatttcctaaaggacgtgtatcacctattcaacaacggcaaatgacaactaat
caaagtacaaatgttcatgccattgccattgaaggaaattttgatgattgccaagctctt
gtcaaagcaatgtttaatgatcatcattttcgtaaaaaaagagctctttcaggtgttaat
tctataaattgggcgcgtattatggcgcaaattgtttactatttttcatctgcactttct
ttaggtgctcctgatagagctgtttcatttactgttcctactggaaattttggtgatatt
tttgcaggttatgttgctgctcgtatgggattacccattgctcaattggttattgcaacg
aatgataatgatatccttgcacgtacattgaccagcggtacttacgaaacacaaccaatc
gtccatacaacctcaccttctatggatattcaagtctcttctaattttgaacgtttactt
tttgaaagtggtaatcgtgatccaatgtggattcgcaacgcaatggaaaatttgaaaaaa
atgggatctttcactcttaatgaaaagcaactcaaaaatattcgttctctcttttccgct
ggaaaaagtaacatggctgaaaccgcacaaacaattgatcgtgtctataaagaaagtgga
tatcttgtcgatccacatacagccgtcgcccttaaagtagcgcgcgaaaataaaaaaccg
catattccaatgatcgtccttgccacggcgcatccggctaaatttcctgatacgattaaa
aatgcttgtggacttcatgccccatggccatctcatctcaatgatatcatggaaggtgaa
gaacacttcataagtcttgctaatgatgaaaaaacagtcaaagattatatttctttaaaa
tcgcgtgcatcttattaa

DBGET integrated database retrieval system