KEGG   Bartonella tribocorum: Btr_0828Help
Entry
Btr_0828          CDS       T00636                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
btr  Bartonella tribocorum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Btr_0828
   00240 Pyrimidine metabolism
    Btr_0828
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Btr_0828
   03430 Mismatch repair
    Btr_0828
   03440 Homologous recombination
    Btr_0828
Enzymes [BR:btr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Btr_0828
DNA replication proteins [BR:btr03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Btr_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876430..876876
Genome map
AA seq 148 aa AA seqDB search
MDILFYHLTQSTLKDILPTLVERALARFGKVTIQCVSKEQRDSIDMHLWVYADESFIGHG
TECDQYANLQPVFLTIGQENPNDSKIRFLIEGAVCSDINVYQRLVVLFDGRNDEQLNFAR
AQWKKYKMENHNLTYWQQTEDRCWEKQV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggatattttattctatcatttgacgcagtcaacgctgaaagatattttgccaacgctt
gtggagcgtgcattggctcgttttggtaaggtaacaatacaatgcgtgagtaaagaacaa
cgcgattctatcgatatgcatttatgggtttatgctgatgaatcatttattggacatgga
acggagtgtgatcaatatgcaaatcttcagcctgtatttctgacgataggacaagaaaat
ccgaatgattcaaagattcgttttctcatagagggagctgtttgttcggatattaatgtt
tatcaacggcttgtcgtgctctttgatggtagaaatgatgagcagttgaattttgctcgg
gcacagtggaaaaaatataaaatggaaaatcataatttaacctattggcaacaaactgaa
gatcgttgttgggaaaaacaagtttaa

DBGET integrated database retrieval system