KEGG   Bartonella tribocorum: Btr_0845Help
Entry
Btr_0845          CDS       T00636                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
btr  Bartonella tribocorum
Brite
Enzymes [BR:btr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Btr_0845 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900507..901166
Genome map
AA seq 219 aa AA seqDB search
MGQKDILQFREELAALVLKMRSKGIDDVRFFSALEKIPRQQFVSAPWFNSAYDNKVIPLE
CGEYMERLEEQLLILAALSLKKKHRVLEIGTGSGFCTALMACLSDRVTTIDRYKTLVDLA
RQKFQTLGIENIVIRQIDGNHSVTGLGSFDRILIWPSRSDEPKEFLELLAENGILIQAIG
PDEGVQTVTRYTKIGCRFECLELFQVRYQPFIKGIAEIL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaaaggatattttacaatttcgtgaggagttggctgctcttgtactgaaaatg
cgtagcaaaggcatcgatgacgtgcgatttttttcggcattagagaaaattccacgtcaa
caatttgtttctgctccttggtttaatagtgcttatgataataaagttattccccttgag
tgtggtgaatatatggaacgtttggaagaacaactcttgattcttgcggcactatcattg
aaaaaaaagcaccgtgtcttagaaattggtacaggctctggcttttgtacggctcttatg
gcatgtttgagtgaccgtgtgacaacgattgatcgttataaaacgcttgttgatttggct
cgccaaaaatttcaaactttaggcatcgaaaatattgttatacggcagattgatggaaat
catagtgtgacaggtttgggatcatttgatcgcatccttatttggccatcacgttctgat
gaacccaaggaatttttagaacttttagctgaaaatggaattctcattcaggcgatagga
cctgatgaaggggtacaaacggtgacgcgctatacaaaaattgggtgtcgatttgagtgt
ttagaattgtttcaagtgcgttatcaaccttttattaaaggtattgcggagatactttaa

DBGET integrated database retrieval system