KEGG   Bartonella tribocorum CIP 105476: Btr_0852Help
Entry
Btr_0852          CDS       T00636                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btr  Bartonella tribocorum CIP 105476
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Btr_0852 (tpiA)
   01230 Biosynthesis of amino acids
    Btr_0852 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btr_0852 (tpiA)
   00051 Fructose and mannose metabolism
    Btr_0852 (tpiA)
   00562 Inositol phosphate metabolism
    Btr_0852 (tpiA)
Enzymes [BR:btr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Btr_0852 (tpiA)
Exosome [BR:btr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Btr_0852 (tpiA)
  Exosomal proteins of bladder cancer cells
   Btr_0852 (tpiA)
  Exosomal proteins of melanoma cells
   Btr_0852 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909842..910606
Genome map
AA seq 254 aa AA seqDB search
MSLNIRPFLAGNWKMNGTRESLGELRAIATGVSSNSGHLFEALICVPATLLSRAYDTLNG
ESLLLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQENDAIVCAKVQAA
WHAGLVALVCIGETLEERDNNKVMDVLAQQLEGSLPDDTTAENTIIAYEPVWAIGTGNTA
TSEDIAKVHYFIRDKICSRFGDEGNKIRLLYGGSVKPSSAFELLSIPHVNGALIGGASLK
AIDFLTICDVCRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaaatattcggccttttcttgctggaaattggaaaatgaatggaacgagagaa
tcgcttggagagttacgtgctattgcaacgggcgttagctctaattcaggtcatctattt
gaagcactcatttgtgttcctgcaacgcttttatcgcgtgcttatgatacgctgaatggt
gagagtctccttttaggaggacaaaattgtcactttgatgattatggtccttatacggga
gatatttcagcttttatgcttaaagaagcaggagcaagtcacgttattattgggcattcg
gaacgtcgtacagtgtatcaagaaaatgatgcaattgtctgtgctaaagtgcaagcagcg
tggcacgctggtcttgtggctcttgtgtgtattggtgaaacattagaggagcgcgataat
aataaagtaatggatgttcttgcgcagcagcttgaaggatctttaccagatgatacaaca
gcagagaataccattatcgcttatgaacctgtctgggcgataggtactggtaatacggca
acttcagaagatattgcaaaagtgcattatttcattcgtgataagatatgctctcgtttt
ggtgatgaaggaaacaagatacgtttgctttatggtggatccgtcaagccatccagtgcc
tttgagcttttaagcattcctcatgttaatggggctttgatcggtggagccagcttaaaa
gccattgattttttaacgatttgcgatgtttgtcgcaaattatag

DBGET integrated database retrieval system