KEGG   Bartonella tribocorum CIP 105476: Btr_1329Help
Entry
Btr_1329          CDS       T00636                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btr  Bartonella tribocorum CIP 105476
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Btr_1329 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btr_1329 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Btr_1329 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Btr_1329 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Btr_1329 (adh)
   00626 Naphthalene degradation
    Btr_1329 (adh)
Enzymes [BR:btr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Btr_1329 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416887..1417915
Genome map
AA seq 342 aa AA seqDB search
MRALQLLNERQLEITNIAPPPSPRPDEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLIIG
AEASGEIAQLGSHVKNLHLGQIVSIYGAQTCGVCQACHEGQDNLCTDVKGVYGFHLDGFA
CDLVNLPARLLVPAPPQCDEFQAAVAPITFGTVEHMLFDNAKLQAGETVLIQAGGSGIGS
AAIQLAKHRGCTVITTVGSDEKIAKAHSLGADHVINYRKDRFEGVVRKLTQKKGVDVVFE
HVGVDTWNGSLLCMKKGARLVTCGSTSGVSASINLMQLFQQQLKIFGSFGCRMENMKNAM
QKMAQKAVHPVIDTIVGLDEMDTALKRMESRDVFGKIILKIN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgctacaattgctaaatgaacgccagcttgaaattactaatattgcaccacct
ccttcacctcgaccagatgaggtaacagtgcgtataaaagctgttgcactcaatcatatt
gatgtatggggctggcgtggaatggcttttgcgaaaagaaaaatgcccctcatcattggt
gccgaagcttccggtgaaattgcgcaactgggaagccatgttaaaaatttacaccttgga
caaatcgtctcaatttatggtgcacaaacctgcggagtatgccaagcttgtcatgaagga
caggataatctttgcacggatgtaaagggagtttatggttttcatcttgatggttttgct
tgtgatcttgtcaatttaccagcacgtttattggttccagcccctccccaatgtgatgaa
ttccaagccgctgttgctcccattacttttggtaccgtagaacatatgcttttcgataac
gcaaaactacaagcaggagaaacagttctgatacaagcaggtggttctggtattggctct
gcagccattcaacttgcaaaacacaggggatgcaccgttattaccacggtaggttcagat
gaaaaaattgcaaaagcacactctcttggagcagatcatgtgattaattatcgtaaagat
cgttttgaaggtgtggtgcgtaaattaactcaaaaaaaaggtgttgacgttgtttttgag
catgttggtgtcgatacatggaacggttctctgttgtgtatgaaaaaaggagcacgctta
gtgacttgcggttctacctctggtgtttcagcatccataaatctcatgcaattattccag
caacaacttaagatatttggttcatttggctgccgtatggaaaatatgaaaaatgccatg
caaaaaatggcacaaaaagccgtacatcctgtcattgatacgattgttggactcgatgaa
atggatacagctttaaaacgaatggagagccgtgatgtttttggtaaaattattcttaaa
atcaattaa

DBGET integrated database retrieval system