KEGG   Bartonella tribocorum: Btr_1334Help
Entry
Btr_1334          CDS       T00636                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btr  Bartonella tribocorum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Btr_1334
Enzymes [BR:btr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Btr_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421800..1422717
Genome map
AA seq 305 aa AA seqDB search
METPLYPIDWGSTPPNIHYGTLKIATDRKIRFAITYPEAKKSKGTIVILESDVNALETYL
LAINEISQRGFHTAIFDWFDPPKISFKTRKKSRQYYFDINNDINDLYEFLKNVVYPICPP
PYSMLAYGIGGLVALSGLDVINHQFNRLICVSPLFAPLGNKTNGFQHKLTQFLSDIGFGF
IPVKNGKKLKKIPPQNIQLGNIHQESLPSTKPPTSQWMASVFNVIDSVKKNIRHGHLQIP
TLFILANQNNLANNIEVRQLCQHTHLTESITITGAELDTIMYNEDHKKQFWAAFDAFIPD
NVSIK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacacctctttatcccatagactggggttccactcctcctaatatccattatggt
acccttaaaatagcaacagatcgcaaaattcgttttgcgataacatatcctgaagcgaaa
aaatctaagggaacaattgttattcttgaaagcgatgtaaatgctttagaaacatatctg
ttagccataaacgaaatttctcaacgtggttttcatacagcaatatttgactggtttgat
ccccccaaaatatccttcaagacaagaaaaaaaagccgacaatattactttgatataaac
aatgatattaatgacttatatgaatttcttaaaaatgttgtttatcctatttgtccacca
ccttactctatgctcgcctatggtatagggggattagtggcactgagcggattagatgtc
attaatcatcagtttaatagattgatctgcgtttctcccctttttgctccattgggcaat
aaaacgaatggttttcaacataaattaacacaatttctttctgatataggttttggcttt
ataccagtgaaaaatgggaaaaaattaaaaaaaattcccccccaaaatatacaattagga
aacatacatcaagagtcactcccttccactaagccaccaacatcccaatggatggcttca
gtatttaatgtaattgattctgtgaagaaaaatatacgccacggacatttacaaatccca
acactctttattcttgctaatcaaaacaatcttgccaacaacattgaagtacggcaatta
tgccaacacacacatctgacagaaagtattactattacaggtgctgagcttgatacaatc
atgtataatgaagatcacaaaaaacaattctgggctgcatttgatgcatttatccctgac
aatgtatctataaaataa

DBGET integrated database retrieval system