KEGG   Bartonella tribocorum: Btr_1341Help
Entry
Btr_1341          CDS       T00636                                 

Gene name
purM
Definition
phosphoribosylaminoimidazole synthetase (EC:6.3.3.1)
Orthology
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
btr  Bartonella tribocorum
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:btr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429341..1430432
Genome map
AA seq 363 aa AA seqDB search
MSNQDLINNKSKAGLTYAKAGVNIDMGNAMVEKIKPFIRATKRAGADAEIGGFGGLFDLK
AAGFTDPILVAANDGVGTKLKIAIEVGHHNTVGIDLVAMCVNDLLVQGAEPLFFLDYFAT
GKLDPEQGAAIVSGIAEGCKQSGAALIGGETAEMPGMYAEGDYDLAGFAVGACERSMLLP
SKNLTEGDIILGLSASGIHSNGFSLVRRIIEQNDLKWNDPAPFDPSNNLGVALLTPTRIY
VKSLLPIMRKYEGVKALAHITGGGFLENIPRVIPSSLCAEINLSTINVPSVFSWIAKQGK
IEETEMLRTFNCGIGMIIIVGQHTAEAVTQALEKNGETVTPLGILTKRQDQNKGILYRGV
LHL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaagatcttataaataataagtccaaagctggtcttacctacgcaaaagcc
ggtgtaaacatcgatatgggtaatgctatggtggaaaaaattaaaccctttatacgcgcg
acaaaacgagcgggagcagatgcagaaattggcgggtttggtggcctttttgatttaaaa
gcagcgggtttcacagatcctatcttagtcgcagccaatgatggtgtgggaacaaaacta
aaaattgccattgaagtggggcaccataacactgtaggcattgatctggtcgctatgtgt
gtcaatgatttacttgtacaaggggcagaacctcttttttttctggattattttgcaact
ggaaaacttgatcctgaacaaggtgccgcaatcgtttctggtattgcagaaggatgtaaa
caatccggtgcggctctcattggaggagaaactgcagaaatgccaggaatgtatgcagaa
ggagattatgatctagcaggttttgctgtaggcgcatgtgaacgcagcatgctgctccct
tcaaaaaacctaacagaaggtgatattatcttaggtttaagcgcctctggaattcattcc
aacggcttttcacttgttcgacgaatcattgagcaaaatgatctcaaatggaatgaccct
gccccttttgatccctcaaataaccttggtgtagcgctcctgacaccaacacgcatttat
gtgaaatcgcttcttcctattatgcgaaaatacgaaggagttaaagctctagcgcatatt
acgggtggaggttttctcgaaaatattccacgtgtcattccctcttctctctgcgctgaa
attaatctttctaccatcaatgttccctccgtcttttcatggattgccaaacaaggtaaa
atagaagaaacagaaatgttacggacattcaattgtggtattggtatgatcattatcgtg
ggacagcatacagctgaagcagttacgcaagctcttgaaaaaaatggagagactgtaact
ccccttggcattttaacaaaacgccaagatcaaaataaaggaatactttatagaggagta
ctgcatttatga

DBGET integrated database retrieval system