KEGG   Bartonella tribocorum: Btr_1533Help
Entry
Btr_1533          CDS       T00636                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
btr  Bartonella tribocorum
Brite
Enzymes [BR:btr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Btr_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1623961..1624635)
Genome map
AA seq 224 aa AA seqDB search
MVADFAELRRKMVDNQIRTVDVTDLSVLEAFLTISREDFVSEDVKALSYLDADIVVCPER
DEVPARYLMKPASLAKLLQLAAVKSSDVVLDIGANSGYCAALLSKLAGSVIALESNDSLF
ERAVEALERNQCDNVVVIHGPLEQGYAVEGPYDVIFIEGSVDFIPQGIFDQMKDGGRLVV
VEGHGNAAVARIYIKEDGIISARRAFNLAVKPLSCFLKTSDFVF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagattttgctgagcttcgtcgcaaaatggttgacaatcaaattcgtacagtc
gatgtaacggatttatcagtgcttgaagcttttttaacgatatctcgtgaagattttgta
tcggaagatgtgaaagcattaagctatcttgatgctgatattgttgtatgtccagagcga
gatgaggttcctgcacgctatttgatgaagcctgcatctcttgcgaaattattacagctt
gctgctgtaaaatcatcagatgttgttttagatattggtgcaaatagtggttattgtgca
gccttgctttcgaaacttgcagggtctgtgattgcgttggaaagtaatgattctcttttt
gagcgtgctgttgaagctttagagcgtaatcaatgtgataatgtggttgttattcatggt
ccattagagcagggatatgctgttgaggggccttatgatgtgatttttattgagggatct
gtcgattttattccacaaggtatctttgatcaaatgaaagacggtggacgtcttgtggtg
gttgaagggcatggaaatgcagctgtagcacgaatctacatcaaagaagatggaattatt
tcagcccgtcgtgcttttaatctcgctgtaaagcctctttcttgttttttaaaaacatct
gattttgtattttag

DBGET integrated database retrieval system