KEGG   Bartonella tribocorum CIP 105476: Btr_1739Help
Entry
Btr_1739          CDS       T00636                                 

Gene name
res1
Definition
restriction enzyme of type III restriction-modification system (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
btr  Bartonella tribocorum CIP 105476
Brite
Enzymes [BR:btr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Btr_1739 (res1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1846296..1849271
Genome map
AA seq 991 aa AA seqDB search
MKIKFDPNQHHQRRAWESAVGVFEGQELDKALFSMPSLSKNEFETHLTQQSDIGFGNRLR
LLPEEILENIQNIQLRNGLKQTKELKSFDFTIEMETGTGKTYVYLRSIFEMNKRYGFSKF
IIVVPSIAIKEGVFKTLEMARAHFKEQYDNIPFDYFVYDSSRLEKVRSFASNDYIQIMVI
NIDAFRKSFTDPSKETSANIIHRWNDKMQGVPIDFIKSTHPIVIIDEPQSVDTTAKSGEA
IKALNPLCTFRYSATHIDKHNMLYKLDSIDAYEKKLVKQIEVASIQVKDGHNKAYIKLLA
VDNKKGHRAKIELDIQQKNTIKRTEKWVKQGDDLLRISGGRSLYDGYVINDIYCEESNEY
IDFTSKPDIIRLHHAIGDVNEDEYKRLQIRKTIEEHLDKELKLTPMGIKVLSLFFIDKVA
NYRDYTALEQKGKYALIFEEEYAKAIKKPKYHSLFSEMDTDSLASQVHNGYFSGDKNGVK
DTNGFTKADEDTYSLIMKDKEKLLSFSSKLKFIFSHSALKEGWDNPNVFQICTLNETKST
IKKRQEIGRGLRIAVNQNGERVHGFEVNTLTVMANESYETFVDDLQKEIEKEEGICFGII
EEHAFANIVIEKNTGEQVFLGAKASEILWNNFLAKQYIDQHGKVTDKLKKALKEDSLTLP
QQFEAQKEAITATLKKVAGGLNIKNNEDKRTVYLNKAIFESSEFKELWDRIKYKTIYNVE
FNPNKLIEKCATSIQNNLIVSKTKFNYTRAKTEISKAGVNITESKESTHIYDVRDYQIPD
ILSYLQNETNLKRCSILDILLKSGRLNDFKNNPQKFIDEVTRLIKREMQRFIIDGIKYYK
IGDQHFYAQELFESEELIGYLNKNMIASDKSAYDHIIYDSDIESDLAQSFEKNEEIKVYA
KLPKWFKIDTPLGSYTPDWAVLFEQDGQEKLYFVVESKGSIFEDMLRELEKAKIHCGREH
FKALGVNTQYIVSDNYDTFINQATQKNTVTT
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaatttgaccccaatcaacaccatcaacgtcgtgcatgggaatctgctgta
ggagtttttgagggtcaagaacttgataaagcactgttctctatgccttcattaagcaaa
aatgaatttgaaactcacttaacacagcaaagtgatataggctttggcaaccgcttacgt
cttttgcctgaagaaatattagaaaacatccaaaatattcaactccgtaatggtttaaag
caaaccaaagagttaaaaagctttgattttaccattgaaatggaaacaggtacgggcaaa
acctacgtatatctacgatctatttttgaaatgaataaacgttatggtttttcgaaattt
attattgtggttcctagcatcgcgattaaggaaggcgtttttaaaactctagaaatggca
agagcacattttaaagagcaatatgataatatcccctttgactattttgtttatgactcc
agccgattggagaaagtccgtagttttgcgagcaatgattatatccaaattatggtgatc
aatattgatgctttccgcaaaagctttacggatccatcaaaagagaccagcgcaaatatt
atccaccgctggaatgataaaatgcaaggcgtaccgattgacttcataaaatctactcac
cccattgtgattattgatgaaccgcaaagtgtggacacgaccgccaaatcaggagaagcc
atcaaagctcttaatccactttgcaccttcagatactctgcgacacatattgataaacat
aacatgctctataagctagattccattgatgcctatgagaaaaaattagtaaaacagatt
gaggttgcttctattcaagtcaaagatgggcataataaagcgtatattaagctattggct
gttgataataagaaaggtcaccgcgccaagatcgaactagatattcagcaaaaaaacacg
attaaacgtactgaaaagtgggtaaaacaaggagatgacttgcttcgtatatctggcggt
cgctctctttatgatggctatgttatcaatgatatttattgcgaagaaagcaatgaatat
atcgacttcaccagtaagccagatattattcgcctgcaccatgcgattggtgatgtgaat
gaggatgagtacaaaagactacaaatccgcaaaacgattgaagagcatttagataaagag
ctaaagctcacaccaatgggaattaaggtccttagtctttttttcattgataaagtagcg
aattaccgagactacactgctttggagcaaaaaggcaaatacgctctcatttttgaagaa
gaatatgcaaaggcaattaaaaagccgaaataccatagccttttttctgaaatggacacg
gatagtctagcctcacaggttcacaatggttatttttctggtgataagaatggtgttaaa
gataccaacggttttacaaaagctgatgaagatacctatagccttattatgaaagataag
gaaaaacttcttagtttttcttctaagttaaagtttattttttctcattccgctctcaaa
gaaggatgggataatcccaatgtcttccagatctgtacacttaatgaaacaaaatctacc
ataaaaaaacgccaagaaattggacgcgggcttcgtattgctgtgaatcagaatggggaa
cgggtccacggttttgaggttaatacactaacggttatggctaacgagtcctacgaaact
tttgtcgacgatctgcaaaaggaaatagaaaaagaagagggtatatgttttggtattatt
gaagaacatgcctttgccaatatcgtcattgagaaaaacaccggagagcaagtgtttctt
ggtgcaaaagcctcagagattctttggaataatttcttggcaaaacaatatattgaccaa
cacggcaaagtaacagacaaactaaaaaaagctctgaaagaagatagccttacacttcct
caacaatttgaagcgcaaaaagaagcgattacagccactcttaaaaaggttgctggcgga
ttaaatattaaaaacaatgaagataaacgcacagtatacttaaacaaagctatttttgaa
agttctgaatttaaagaattatgggatcgtattaaatataaaactatctataatgtggaa
tttaatccaaataagcttattgaaaagtgtgccacgagcattcaaaataacctcatcgtc
agcaaaacaaagttcaattatactcgagcaaagactgaaatcagtaaagccggtgtgaac
atcactgaaagtaaagaaagcactcatatatatgatgtgcgtgattatcaaattccagat
attttaagttacctccagaatgaaacgaatcttaagagatgctccattcttgatatctta
ctcaagagtgggcgcttgaatgacttcaaaaacaatccccaaaaattcattgacgaagta
acaaggcttatcaagcgtgagatgcagcgttttataattgatggtatcaaatactacaaa
attggtgatcaacatttttatgcacaagagctttttgaaagtgaagagttgattggatat
ttgaataaaaatatgattgcatccgataaatcggcctatgatcatattatttatgattca
gatattgaatctgatcttgcacaatcatttgaaaaaaatgaagagataaaagtttatgcc
aaactgcctaagtggtttaaaattgataccccccttggatcatatacccctgattgggct
gttttattcgagcaagacggacaagaaaaactgtattttgttgtggaaagtaaagggagt
atttttgaagacatgttgcgtgagctagaaaaagcaaaaatccattgcggtcgcgaacat
tttaaagctttaggagtaaatacccaatatattgtttcggataattatgatacttttatc
aatcaagcaacgcaaaaaaatacagtaacaacttga

DBGET integrated database retrieval system