KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_13710Help
Entry
F544_13710        CDS       T03019                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:btra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F544_13710
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F544_13710
  Energy metabolism
   00680 Methane metabolism
    F544_13710
Enzymes [BR:btra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     F544_13710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1508872..1511505
Genome map
AA seq 877 aa AA seqDB search
MDQSIRSNIQMLGDFLGETIRDSQGNDILELIENIRILSRDSRHGDEQAREKLLDMLANI
ADDNVIPVARAFSQFLNLTNIAEQYHSISRSNQQKVDTLGRSLGALFTRLKAQNVPAEKV
VATVNKLLIDLVLTAHPTEVTRRSLVNKHVEINRCLSRLEHNDLTEAETTKLKRRLLQLI
ALAWHTNEIRTQRPTPVDEAKWGMAVIENSLWKAVPDFCRQINLQLEKHFGVQYSVELAP
VRFSSWMGGDRDGNPFVTAQTTRRVLQMQRWKAAELFLEDIRGLSDELSVVQCTPEFRAK
YGDHLEPYRVVIKALRTKLIKTVAYYAELLEDRPLTIRQDEILTEDNQLWEPLYDCYQSL
HQCGMRIIANGALLDCLRRIRCFGLGLSRLDIRQESTRHANAIGEITRYIGLGDYTQWTE
EDKQAFLVRELSSRRPLIPTDWTPSAETQEVLDTCKVVAEQAQGTISAYVISMAQEASDV
LAVHLLLKEAGCKANIPVAPLFETLDDLERCESVMETLFSIGWYRGVINNYQMVMIGYSD
SAKDAGMLAASWAQYKAQEALVNLCEKYHIELTLFHGRGGTIGRGGAPAHAALLSQPPRS
LKNGLRVTEQGEMIRFKLGLPGVAIVSLDLYASAILEANLCPPPEPKQSWRNVMEQSAAT
SCEIYRGIVRGEPDFVPYFRAATPEQELSKLPLGSRPAKRNPNGGVESLRAIPWIFAWMQ
NRLMLPAWLGAGKALQQLIEQGNETLLKEMCAQWPFFSTRIGMLEMVFSKVDLWLAEHYD
QRLVPSHLHRLGKELRSQLQADLQTVLSLSHDGQLMADLPWVADSIALRNVYTDPLNLLQ
VELLHRLRSQGDSADPALEQALMITITGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atggaccaatccattcgcagtaatattcaaatgcttggcgattttttaggagagactatc
cgtgattcgcaaggcaatgacattttagagctgatagaaaatatccgcattctctcgcgc
gattcccgccatggagatgagcaagctcgggaaaagctccttgatatgctggcaaacatt
gcagatgataacgttattcccgtggcccgagcctttagccaattccttaacctcaccaat
attgctgaacaataccactctatttcgcgtagtaatcaacaaaaagtagatactctagga
cgttcactcggtgcactctttactcgtttaaaagcacaaaacgttccagccgaaaaagtg
gttgcaacggtcaataaattactcattgatttggttctcactgcccacccaacagaagtg
acccgccgttcattagtgaataaacacgtagaaataaaccgctgcttaagccgtttggag
cataatgacttaactgaagcagaaacgacaaaacttaaacgccgtctcttgcaattaatt
gctctggcttggcatactaatgaaattcgcactcaacgtccaacgccggttgatgaagcc
aaatggggaatggccgttattgaaaatagtttatggaaagccgtacctgatttttgtcgc
caaatcaatcttcaactcgaaaaacactttggagtgcaatattctgtagaactcgcgccc
gtccgtttctcttcttggatgggtggagatcgcgatggaaacccattcgttactgcgcaa
acgactcgtcgtgtgctacaaatgcaacgctggaaagcggctgaactattcttagaagat
attcgtgggctatccgatgaactttctgtggtgcaatgtacgcctgagttccgcgcaaaa
tatggtgatcatttagaaccctatcgcgtggtaattaaagcattacgtactaaattaata
aaaaccgttgcctattatgctgaattgttggaagaccgcccgctaaccatccgtcaagat
gaaattttgaccgaagataatcagctttgggagccactctatgattgctaccaatcactg
catcagtgtggtatgcgcattattgctaacggggctttgctcgattgtctgcgccgcatc
cgttgctttggtttaggactgtcgcgtttggatattcgtcaagaaagcacacgtcatgct
aatgctattggcgaaattacacgttatattggcttgggcgactatacacagtggacagaa
gaagataaacaggcctttttagtgcgtgagctcagttctcgtcgcccattgattccaacc
gattggacaccatccgctgaaacacaagaagtgctagatacctgcaaagtagttgctgag
caagcacaaggcacgatttctgcttatgttatctctatggctcaagaagccagcgatgta
ttagctgtgcacttgttactcaaagaagccggttgtaaagccaatatccctgtcgcacca
ttgtttgaaaccttagacgatctagaacgttgtgaaagcgtgatggagaccttattctca
attggttggtatcgtggtgttatcaataactaccaaatggtgatgattggctactccgat
tctgccaaagatgcgggaatgctagctgcctcttgggcacaatataaagcacaagaagct
ctcgtaaatttatgcgagaaatatcatattgagctcaccctcttccacgggcgtgggggt
actattggtcgtggtggcgctccagcacatgcggctcttctctctcaacctccaagatca
ctcaaaaatggtttacgtgtgaccgagcaaggcgaaatgattcgctttaaacttggctta
ccaggcgtggctattgtcagcttagatctttatgcgagtgcgattcttgaggcaaatctc
tgccctcctccagaaccaaaacagagttggcgcaatgtcatggaacaaagcgcagcaacc
tcttgcgaaatctatcgtggtattgtacgaggcgagcctgattttgtaccatacttccgc
gcggctacacctgagcaggaactctctaagctaccgctgggatctcgaccggctaagcgt
aatcctaatggcggggtagaaagcttacgtgctattccatggatctttgcatggatgcaa
aaccgcttaatgttgccagcatggctgggggctggtaaagctctgcaacaattaattgag
caaggtaatgagaccttgctcaaagagatgtgcgctcaatggccattcttctcaactcgt
attggtatgcttgagatggtattcagcaaagttgatttatggcttgctgaacattatgat
caacgtctagtaccaagccatttacaccgtttaggtaaagaattacgtagccaattgcaa
gcagatctacaaacggtattatcactctcgcacgatggtcaattgatggcggatctccct
tgggtggcagattcgatcgctttacgtaatgtatataccgatccacttaaccttcttcaa
gttgagttacttcatcgcttacgtagccaaggtgacagtgctgacccagctcttgagcaa
gccttgatgatcactattacagggattgctgcaggtatgagaaatacaggctag

DBGET integrated database retrieval system