KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_5590Help
Entry
F544_5590         CDS       T03019                                 

Definition
Alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F544_5590
Enzymes [BR:btra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     F544_5590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
572283..574439
Genome map
AA seq 718 aa AA seqDB search
MIPQRAHLGDFVKFYLKLTACKFVFGQFNALSIAMNKSFLYLCLFGVSNLFAQSWQHAHF
GIFSDDAEHHLFQSSAMLTKGNYPLNFLFGERCYQPQTVMKLNQSMPLVPCTADIPSIRL
FRQGNYRAQIDMHNSIPTLKIHLEQLPEKTNAELPCPRWNHTPLEIDVSATFSEGDIVRD
FYSGQHAVVKNGKITLMPAENADGLLLLEKLENHQQAVFDWKNATVYFVLTDRFYNGDPS
NDHSYGRRSDGMQEIGTFHGGDLRGLTEKLDYLQQLGVNVLWISSPLEQIHGWVGGGNKG
DFPHYAYHGYYHLDWTKIDANMGSEADLKNLVQQAHQRGIRILFDVVMNHTGYATLADMQ
EFNFGRFYLKSEEISSVLGKNWTDWQPKQGQNWHSFNDFIHFSDEKAWENWWGRAWVRAD
IGDYDSPKFDDLKMSLSALPDLKTESEQAVQLPQFFANKGTNAQTLENGKVRDYLISWLS
HWVRQYGIDGFRVDTAKHVEKSTWLELKQASEQALKEWQQENPKESFNAPFWMVGEAWGH
GVFQSDYYQNGFDAMINFDFQDQAKNALACFADIEPAYREMNDKLHSFNVLSYLSSHDTR
LFFHSDSEQNIHKQKIAANLLLLSPGAVQIYYGDESGREFGATGSDPVQGTRSDMNWQDL
QQDPAKKLLHQHWQKLAQFRQRHPAIGAGKHQLLSTAQYFAFSRILNTDKVMIIWAGH
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatacctcaaagggcacaccttggggattttgtaaaattttatttaaaactcactgct
tgtaagtttgtatttggtcaatttaatgctctgagtattgctatgaataagtcatttctt
tatctctgcttatttggtgtatcaaatttatttgcacaatcttggcaacatgctcatttt
ggtatttttagtgatgatgcagagcatcatttattccaaagctcagccatgctaaccaag
gggaattacccgctaaattttctgtttggggagcggtgttatcagcctcaaacagtaatg
aaattgaatcaaagtatgccgcttgttccttgcacagcggatattccaagcattcgccta
ttccgccaaggaaattatcgtgctcaaattgatatgcacaatagtatacctacactaaaa
atccatttagaacaattgcctgaaaagacaaatgctgagttaccttgtcctcgttggaat
catactccccttgaaattgatgtttctgcaactttttcagagggagatattgtgcgggat
ttttattcaggtcaacacgcagtggttaaaaatggcaaaattactttaatgccagcagaa
aacgcagatggtttattattgttagaaaagcttgagaatcatcagcaagcagtatttgat
tggaaaaatgctaccgtttattttgtgctaactgatcgattttataatggagatccaagc
aatgatcatagctatggtagacgtagtgatggtatgcaggaaataggtacatttcatggc
ggagacttaaggggattaactgaaaagttagattacttacagcagcttggtgtcaatgta
ttatggattagttcaccattagagcagatccatggctgggtaggtggtggaaataaaggg
gattttccgcattatgcttaccacggttactatcatttagattggacaaaaattgatgcc
aatatgggcagtgaagccgatttaaaaaatctagtgcaacaggctcatcaacgtggtatt
cgtattctatttgatgttgtgatgaatcatacaggctatgcaacgttagcggatatgcaa
gaattcaattttggtcgtttttatttaaaatcagaggaaatatcgagtgtattaggcaaa
aattggacagattggcaaccgaaacaaggccaaaattggcatagctttaatgattttatt
cattttagtgatgagaaagcgtgggaaaattggtggggaagggcatgggtgcgtgccgat
attggcgactatgacagtccgaagtttgatgatttaaaaatgtcgttatcagccctacct
gatcttaaaaccgagagtgaacaagcggttcaattacctcaattttttgcaaataaaggt
acaaatgcccaaacgctagaaaatggtaaagtgcgtgattatttaattagttggctttcc
cattgggttcgtcaatatggtattgatggctttagggtagatacagcaaaacatgttgaa
aaatcaacttggctagagttaaaacaagcttctgaacaagcgttaaaagaatggcagcaa
gaaaatccaaaagaaagctttaatgcgcctttttggatggttggtgaagcttggggacat
ggtgtatttcaaagtgattattatcaaaatggctttgatgcgatgatcaattttgatttt
caagatcaagctaaaaatgcattagcatgttttgcggatattgaaccagcttaccgcgaa
atgaatgataagttacatagtttcaatgtattaagttatttatcttcgcatgatacccga
ttattttttcattcagatagcgaacaaaatattcataaacagaaaatagccgcaaattta
ttgttgctgtcaccaggagctgttcaaatttactacggggatgaaagcggtcgggaattt
ggtgcaacgggttcagatccggtgcaaggtactcgatcagatatgaattggcaagactta
caacaggatccagccaaaaagctgctgcaccagcactggcaaaaattagcgcagtttaga
caacgtcaccctgccattggcgcaggtaagcatcaattgcttagtactgcgcaatatttt
gcttttagtcgcatattaaatactgataaagttatgattatatgggctggccattag

DBGET integrated database retrieval system