KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_630Help
Entry
F544_630          CDS       T03019                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F544_630
Enzymes [BR:btra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F544_630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
61556..62479
Genome map
AA seq 307 aa AA seqDB search
MKTLCVLGSINVDHVIRVPYFPKSGETLAGHSYQIAYGGKGANQAVAAARLGAKVKFIGA
IGDDAIGQTMKSAFEQDGIDTQAIEVIPNQSTGLAMIQVSDEGENSIVISAGANANLSTD
RVAQQRTAIELADILLMQLESPLQAVEFAAKIAKKSGTLVVLNPAPAQALSDELLECVDI
ITPNETEAEILTGVKVENAQTAAQASAVFHQKGIMTVLITLGAKGVYLSEQGRGGEIIRG
FHVQAIDTTAAGDTFNGGFVTALLEGKTLSQAIRFAHAAAAISVTRLGAQTAIPYRSETL
AFLSQHI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctctgcgttctcggtagtatcaatgttgatcacgttattcgcgttccctat
tttcctaaatcaggtgaaacattagcagggcatagctatcaaattgcctatggcggaaaa
ggcgcaaatcaagcagtggcagcagctaggctaggtgcaaaagtaaaatttatcggtgca
attggcgatgatgcgattgggcaaacaatgaaatctgcttttgagcaagatggtattgat
actcaggcgattgaagtgatccctaatcaatcaacgggcttggcgatgattcaagtttct
gacgagggagagaattctattgttatttcagcaggggcgaatgcaaatttaagcacagat
agagtggcacaacagcgcacagcgatcgagctcgcagatatactcttaatgcaattggaa
agcccgttacaagcggttgaatttgcagcaaaaattgcaaaaaaatcagggacactggtg
gtattaaatcccgcgccagcgcaagcattatcagatgagctgttggagtgtgtggatatt
attacgccaaatgaaactgaagcagagattttaactggagtgaaggtggaaaatgcgcaa
acagcagcgcaggcttcagcagtctttcatcaaaagggcattatgactgttttgattacc
ttgggcgcaaaaggcgtttatttaagcgaacaaggcagaggcggtgaaatcattcgcggt
tttcatgtgcaagccatagataccactgcggcaggggatacttttaatggtgggtttgtt
acggcattattagaaggtaaaacactttcacaagccattcgttttgcccatgcagcggca
gcaatatctgttactcgactgggcgcacaaacggctattccatatagatcagaaacatta
gcttttctttcgcaacatatttga

DBGET integrated database retrieval system