KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-188: F542_16770Help
Entry
F542_16770        CDS       T03017                                 

Definition
Alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
btre  Bibersteinia trehalosi USDA-ARS-USMARC-188
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F542_16770
Enzymes [BR:btre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     F542_16770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1839823..1841877)
Genome map
AA seq 684 aa AA seqDB search
MNKSFLYLCLFGVSNLFAQSWQHAHFGTFNDDAEHHLFQSSAMLTKGNYPLNFLFGERCY
QPQTVMKLNQSMPLVPCTADIPSIRLFRQGNYRAQIDMHNSIPTLKIHLEQLPENTNAEL
PCPRWNHTPLEIDVSATFSEGDIVRDFYSGQHAVVKNGKITLMPAENADGLLLLEKLENH
QQTVFDWKNATVYFVLTDRFYNGDPSNDHSYGRRSDGMQEIGTFHGGDLRGLTEKLDYLQ
QLGVNVLWISSPLEQIHGWVGGGNKGDFPHYAYHGYYHLDWTKIDANMGSEADLKNLVQQ
AHQRGIRILFDVVMNHTGYATLADMQEFNFGRFYLKSEEISSVLGKNWTDWQPKQGQNWH
SFNDFIHFSDEKAWENWWGRAWVRADIGDYDSPKFDDLKMSLSALPDLKTESEQAVQLPQ
FFANKGTNAQTLENGKVRDYLISWLSHWVRQYGIDGFRVDTAKHVEKSTWLELKQASEQA
LKEWQQENPKESFNAPFWMVGEAWGHGVFQSDYYQNGFDAMINFDFQDQAKNALACFADI
EPAYREMNDKLHSFNVLSYLSSHDTRLFFHSDSEQNIHKQKVAANLLLLSPGAVQIYYGD
ESGREFGATGSDPVQGTRSDMNWQDLQQDPAKKALHQHWQKLAQFRQRHPAIGAGKHQLL
STAQYFAFSRILNTDKVMIIWAGH
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtcatttctttatctctgcttatttggtgtatcaaatttatttgcacaatct
tggcaacatgctcattttggtacttttaatgatgatgcagagcatcatttattccaaagc
tcagccatgctaaccaaggggaattacccgctaaattttctgtttggggagcggtgttat
cagcctcaaacagtaatgaaattgaatcaaagtatgccgcttgttccttgcacagcggat
attccaagcattcgcctattccgccaaggaaattatcgtgctcaaattgatatgcacaat
agtatacctacactaaaaatccatttagaacaattgcctgaaaatacaaatgctgagttg
ccttgtcctcgttggaatcatactccccttgaaattgatgtttctgcaactttttcagag
ggagatattgtgcgggatttttattcaggtcaacacgcagtggttaaaaatggcaaaatt
actttaatgccagcagaaaacgcagatggtttattattgttagaaaagcttgagaatcat
cagcaaacggtatttgattggaaaaatgctaccgtttattttgtgctaactgatcgattt
tataatggggatccaagcaatgatcatagctatggtagacgtagtgatggtatgcaggaa
ataggtacatttcatggcggagacttaaggggattaactgaaaagttagattacttacag
cagcttggtgtcaatgtattatggattagttcaccattagagcagattcatggctgggta
ggtggtggaaataaaggggattttccgcattatgcttaccacggttactatcatttagat
tggacaaaaattgatgccaatatgggcagtgaagccgatttaaaaaatctagtgcaacag
gctcatcaacgtggtattcgtattctatttgatgttgtgatgaatcatacaggctatgca
acgttagcggatatgcaagaattcaattttggtcgtttttatttaaaatcagaggaaata
tccagtgtattaggtaaaaattggacagattggcaaccgaaacaaggacaaaattggcat
agctttaatgattttattcattttagtgatgagaaagcgtgggaaaattggtggggaagg
gcatgggtgcgagccgatattggcgactatgacagtccgaagtttgatgatttaaaaatg
tcgttatcagccctacctgatcttaaaaccgagagtgaacaagcggttcaattacctcaa
ttttttgcaaataaaggtacaaatgcccaaacgctagaaaatggtaaagtgcgtgattat
ttaattagttggctttcccattgggttcgtcaatatggtattgatggctttagggtagat
acagcaaaacatgttgaaaaatcaacttggctagagttaaaacaagcttctgaacaagcg
ttaaaagaatggcagcaagaaaatccaaaagaaagctttaatgcgcctttttggatggtt
ggtgaagcttggggacatggtgtatttcaaagtgattattatcaaaatggctttgatgcg
atgatcaattttgattttcaagatcaggctaaaaatgcattagcatgttttgcggatatt
gaaccagcttaccgcgaaatgaatgataagttacatagtttcaatgtattaagttattta
tcttcgcatgatactcgattattttttcattcagatagcgaacaaaatattcataaacag
aaagtagctgcaaatttattgttgctgtcaccaggagctgttcaaatttactacggggat
gaaagcggtcgggaatttggtgcaacaggttcagatccggtgcaaggtactcgatcagat
atgaattggcaagacttacaacaggatccagccaaaaaggcgctgcaccagcactggcaa
aaattagcgcagtttagacaacgtcaccctgccattggcgcaggtaaacatcaattgctt
agtactgcgcaatattttgcttttagtcgcatattaaatactgataaagttatgattata
tgggctggccattaa

DBGET integrated database retrieval system