KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-188: F542_20960Help
Entry
F542_20960        CDS       T03017                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btre  Bibersteinia trehalosi USDA-ARS-USMARC-188
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F542_20960
Enzymes [BR:btre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F542_20960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2282049..2282972)
Genome map
AA seq 307 aa AA seqDB search
MKTLCVLGSINVDHVIRVPYFPKSGETLAGHSYQIAYGGKGANQAVAAARLGAKVKFIGA
IGDDAIGQTMKSAFEQDGIDTQAIEVIPNQSTGLAMIQVSDEGENSIVISAGANANLSTD
RVAQQRTAIELADILLMQLESPLQAVEFAAKIAKKSGTLVVLNPAPAQALSDELLACVDI
ITPNETEAEILTGVKVENAQTAAQASAVFHQKGIMTVLITLGAKGVYLSEQGRGGEIIRG
FHVQAIDTTAAGDTFNGGFVTALLEGKTLSQAIRFAHAAAAISVTRLGAQTAIPYRSETL
AFLSQHI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctctgcgttctcggtagtatcaatgttgatcacgttattcgcgttccctat
tttcctaaatcaggtgaaacattagcagggcatagctatcaaattgcctatggcggaaaa
ggcgcaaatcaagcagtggcagcagctaggctaggtgcaaaagtaaaatttatcggtgca
attggcgatgatgcgattgggcaaacaatgaaatctgcttttgagcaagatggtattgat
actcaggcgattgaagtgatccctaatcaatcaacgggcttggcgatgattcaagtttct
gacgagggagagaattctattgttatttcagcaggggcgaatgcaaatttaagcacagat
agagtggcacaacagcgcacagcgatcgagctcgcagatatactcttaatgcaattggaa
agcccgttacaagcggttgaatttgcagcaaaaattgcaaaaaaatcagggacactggtg
gtattaaatcccgcgccagcgcaagcattatcagatgagctgttggcgtgtgtggatatt
attacgccaaatgaaactgaagcagagattttaactggagtgaaggtggaaaatgcgcaa
acagcagcgcaggcttcagcagtctttcatcaaaagggcattatgactgttttgattacc
ttgggcgcaaaaggcgtttatttaagcgaacaaggcagaggcggtgaaatcattcgcggt
tttcatgtgcaagccatagataccacggcggcaggggatacttttaatggtgggtttgtt
acggcattattagaaggtaaaacactttcacaagccattcgttttgcccatgcagcggca
gcaatatctgttactcgactgggcgcacaaacggctattccatatagatcagaaacatta
gcttttctttcgcaacatatttga

DBGET integrated database retrieval system