KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_18480Help
Entry
F543_18480        CDS       T03018                                 

Definition
Alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btrh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F543_18480
Enzymes [BR:btrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     F543_18480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1916809..1918965)
Genome map
AA seq 718 aa AA seqDB search
MIPQRAHLGDFVKFYLKLTACKFVFGQFNALNIAMNKSFLCLCLFGVSNLFAQSWQHAHF
GTFNDDAERHLFQSSAMLTKGNYPLNFLFGEQCYQPQAAMKLNQSMPLVPCTADIPSIRL
FRQGNYRAQIDMHNSIPTLKIHLEQLPEKTNAELPCPRWNHTPLEIDVSATFSEGDIVRD
FYSGQHAVVKNGKITLMPAENADGLLLLEKLENHQQTVFDWKNATVYFVLTDRFYNGDPS
NDHSYGRRSDGMQEIGTFHGGDLRGLTEKLDYLQQLGVNVLWISSPLEQIHGWVGGGNKG
DFPHYAYHGYYHLDWTKIDANMGSEADLKNLVQQAHQRGIRILFDVVMNHTGYATLADMQ
EFNFGRFYLKSEEISSVLGKNWTDWQPKQGQNWHSFNDFIHFSDEKAWENWWGRAWVRAD
IGDYDSPKFDDLKMSLSALPDLKTESEQAVQLPQFFANKGTNAQTLENGKVRDYLISWLS
YWVRQYGIDGFRVDTAKHVEKSTWLELKQASEQALKEWQQENPKESFNAPFWMVGEAWGH
GVFQSDYYQNGFDAMINFDFQDQAKNALACFADIEPAYREMNDKLHSFNVLSYLSSHDTR
LFFHSDSEQNIHKQKVAANLLLLSPGAVQIYYGDESGREFGATGSDPVQGTRSDMNWQDL
QQDPAKKVLHQHWQKLAQFRQRHPAIGAGKHQLLSTAQYFAFSRILNTDKVMIIWAGH
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatacctcaaagggctcaccttggggattttgtaaaattttatttaaaactcaccgct
tgtaagtttgtatttggtcaatttaatgctctgaatattgctatgaataagtcatttctt
tgtctctgtttatttggtgtatcaaatttatttgcgcaatcttggcaacatgctcatttt
ggtacttttaatgatgatgcagagcgtcatttattccaaagctcagccatgctaaccaag
gggaattacccgttaaactttctgtttggggagcagtgttatcagcctcaagccgcaatg
aaattgaatcaaagtatgccgcttgttccttgcacagcggatattccaagcattcgccta
ttccgccaaggaaattatcgtgctcaaattgatatgcacaatagtatacctacactaaaa
atccatttagaacaattgcctgaaaagacaaatgctgagttgccttgtcctcgttggaat
catactccccttgaaattgatgtttctgcaactttttcagagggagatattgtgcgggat
ttttattcaggtcaacacgcagtggttaaaaatggcaaaattactttaatgccagcagaa
aacgcagatggtttattattgttagaaaagcttgagaatcatcagcaaacggtatttgat
tggaaaaatgctaccgtttattttgtgctaactgatcgattttataatggggatccaagc
aatgatcatagctatggtagacgtagtgatggtatgcaggaaataggtacatttcatggc
ggagacttaaggggattaactgaaaagttagattacttacagcagcttggtgtcaatgta
ttatggattagttcaccattagagcagattcatggctgggtaggtggtggaaataaaggg
gattttccgcattatgcttaccacggttactatcatttagattggacaaaaattgatgcc
aatatgggcagtgaagccgatttaaaaaatctagtgcaacaggctcatcaacgtggtatt
cgtattctatttgatgttgtgatgaatcatacaggctatgcaacgttagcggatatgcaa
gaattcaattttggtcgtttttatttaaaatcagaggaaatatccagtgtattaggtaaa
aattggacagattggcaaccgaaacaaggacaaaattggcatagctttaatgattttatt
cattttagtgatgagaaagcgtgggaaaattggtggggaagggcatgggtgcgtgccgat
attggcgactatgacagtccgaagtttgatgatttaaaaatgtcgttatcagccctacct
gatcttaaaaccgagagtgaacaagcggttcaattacctcaattttttgcaaataaaggt
acaaatgcccaaacgctagaaaatggtaaagtgcgtgattatttaattagttggctttcc
tattgggttcgtcaatatggtattgatggctttagggtagatacagcaaaacatgttgaa
aaatcaacttggctagagttaaaacaagcttctgaacaagcgttaaaagaatggcagcaa
gaaaatccaaaagaaagctttaatgcgcctttttggatggttggtgaagcttggggacat
ggtgtatttcaaagtgattattatcaaaatggctttgatgcgatgatcaattttgatttt
caagatcaggctaaaaatgcattagcatgttttgcggatattgaaccagcttaccgcgaa
atgaatgataagttacatagtttcaatgtattaagttatttatcttcgcatgatactcga
ttattttttcattcagatagcgaacaaaatattcataaacagaaagtagctgcaaattta
ttgttgctgtcaccaggagctgttcaaatttactacggggatgaaagcggtcgggaattt
ggtgcaacaggttcagatccggtgcaaggtactcgatcagatatgaattggcaagactta
caacaggatccagccaaaaaggtgctgcaccagcactggcaaaaattagcgcagtttaga
caacgtcaccctgccattggcgcaggtaagcatcaattgcttagtactgcgcaatatttt
gcttttagtcgcatattaaatactgataaagttatgattatatgggctggccactag

DBGET integrated database retrieval system