KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_2140Help
Entry
F543_2140         CDS       T03018                                 

Definition
Lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Brite
Enzymes [BR:btrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     F543_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
203651..204190
Genome map
AA seq 179 aa AA seqDB search
MSKSLKYGSGIVCGIAAIIALVEYQHPEIRTSQAGLEIIGNAEGCRRDPYKCPADVITVG
IGSTEFGGEKIDPSRIYSDKEIADRWAKDLKIAESCVNRYGNGKRIPQGAFDSAVSLTFN
VGCNTARKSTLFRKLNAGDIRGACSEFPRWVYASGKKLRGLEIRREKERALCLTGLVAR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagtcttaaatatggcagtggtatcgtttgtggtatcgctgccattattgca
ttagtcgaataccaacaccctgaaatccgcactagccaagcagggttggagattatcggt
aatgcagaaggatgtcgtcgagatccatataaatgccctgctgatgtaattacggttggt
atcggttcgaccgaatttggcggagagaagattgatccaagccgtatttattccgataaa
gaaatcgctgaccgctgggcaaaagatttaaaaattgcggaaagttgtgtcaatcgctat
ggcaacggtaagcgtattccgcaaggtgcatttgattctgcggtttcgctaacctttaat
gttggttgcaatacggcaagaaaatctaccttgtttcgcaagttaaacgctggcgatatt
cgtggggcgtgcagtgaatttcctcgctgggtttatgctagcggtaaaaaattgcgaggc
ttggaaatccgccgagaaaaggagcgagcattatgtttaactggattagtggcacgatag

DBGET integrated database retrieval system