KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_23240Help
Entry
F543_23240        CDS       T03018                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btrh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F543_23240
Enzymes [BR:btrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F543_23240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2395440..2396363)
Genome map
AA seq 307 aa AA seqDB search
MKTLCVLGSINVDHVIRVPYFPKSGETLAGHSYQIAYGGKGANQAVAAARLGAKVKFIGA
IGDDAIGQTMKSAFEQDGIDTQAIEVIPNQSTGLAMIQVSDEGENSIVISAGANANLSTD
RVAQQRTAIELADILLMQLESPLQAVEFAAKIAKKSGTLVVLNPAPAQALSDELLACVDI
ITPNETEAEILTGVKVENAQTAAQASAVFHQKGIMTVLITLGAKGVYLSEQGRGGEIIRG
FHVQAIDTTAAGDTFNGGFVTALLEGKTLSQAIRFAHAAAAISVTRLGAQTAIPYRSETL
AFLSQHI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctctgcgttctcggtagtatcaatgttgatcacgttattcgcgttccctat
tttcctaaatcaggtgaaacattagcagggcatagctatcaaattgcctatggcggaaaa
ggcgcaaatcaagcagtggcagcagctaggctaggtgcaaaagtaaaatttatcggtgca
attggcgatgatgcgattgggcaaacaatgaaatctgcttttgagcaagatggtattgat
actcaggcgattgaagtgatccctaatcaatcaacgggcttggcgatgattcaagtttct
gacgagggagagaattctattgttatttcagcaggggcgaatgcaaatttaagcacagat
agagtggcacaacagcgcacagcgatcgagctcgcagatatactcttaatgcaattggaa
agcccgttacaagcggttgaatttgcagcaaaaattgcaaaaaaatcagggacactggtg
gtattaaatcccgcgccagcgcaagcattatcagatgagctgttggcgtgtgtggatatt
attacgccaaatgaaactgaagcagagattttaactggagtgaaggtggaaaatgcgcaa
acagcagcgcaggcttcagcagtctttcatcaaaagggcattatgactgttttgattacc
ttgggcgcaaaaggcgtttatttaagcgaacaaggcagaggcggtgaaatcattcgcggt
tttcatgtgcaagccatagataccacggcggcaggggatacttttaatggtgggtttgtt
acggcattattagaaggtaaaacactttcacaagccattcgttttgcccatgcagcggca
gcaatatctgttactcgactgggcgcacaaacggctattccatatagatcagaaacatta
gcttttctttcgcaacatatttga

DBGET integrated database retrieval system