KEGG   Bordetella trematum: SAMEA390648702870Help
Entry
SAMEA390648702870 CDS       T04322                                 

Gene name
bktB_1
Definition
(GenBank) thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btrm  Bordetella trematum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:btrm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA390648702870 (bktB_1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMEA390648702870 (bktB_1)
   00640 Propanoate metabolism
    SAMEA390648702870 (bktB_1)
   00650 Butanoate metabolism
    SAMEA390648702870 (bktB_1)
  Lipid metabolism
   00071 Fatty acid degradation
    SAMEA390648702870 (bktB_1)
   00072 Synthesis and degradation of ketone bodies
    SAMEA390648702870 (bktB_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMEA390648702870 (bktB_1)
   00310 Lysine degradation
    SAMEA390648702870 (bktB_1)
   00380 Tryptophan metabolism
    SAMEA390648702870 (bktB_1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMEA390648702870 (bktB_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMEA390648702870 (bktB_1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAMEA390648702870 (bktB_1)
Enzymes [BR:btrm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMEA390648702870 (bktB_1)
Exosome [BR:btrm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMEA390648702870 (bktB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:3053947..3055152
Genome map
AA seq 401 aa AA seqDB search
MNKLRRAAVVAPVRTAVGAFGGALRAMPVEDLAASVVREVVARSGIDPARIDDAVFAQSY
ANSEVPCVGRWAALHAGLPVEVPGMQLDRRCGGGLQAVASAAMMVQTGAADVVLCGGVES
MSNIEYYSMDMRWGKRAGSGSFYDRLERGRERSQPVERFGVISGMIETAENVAQAFSITR
EQSDAYALESHRRASAAHAQGLFRDEIVALDVPQRKGPALRFEKDEGVRAEASLSALARL
RPLLDGGVVTAGNASQQSDAAAACLVVAEDQLERLGLEPMGYLVGWAAAGCEPATMGMGP
VPATAKLMARLGLSLADMDLIEVNEAFACQVLAVLRQWGLHDHARVNVNGSGISLGHPIG
ATGVRIMASLLHEMKRRGARYALETMCVGGGQGVAAVFERA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattgagaagggcggcggtcgtcgcgcccgtacgaaccgccgtcggcgcattt
ggcggcgcgctgcgtgccatgccggtcgaggacctggccgccagtgtggtccgggaggtc
gtggcgcgctccgggatcgacccggcgcgcatcgatgatgcggtgtttgcgcaatcctat
gccaacagcgaggtgccctgtgtggggcgttgggcagcgttgcacgcgggtctgccggtg
gaggtgccgggcatgcagcttgaccgccgttgcggcggcgggctgcaggcggtggcctcg
gcggcgatgatggtgcagaccggcgcggcggacgtggtgctgtgcggcggcgtcgagagc
atgagcaacatcgagtactactcgatggatatgcgctggggcaagcgcgccggcagcggc
agcttctacgaccgcctggagcgcggtcgcgaacgttcgcagcccgtggagcgtttcggg
gtgatctcgggaatgatagagaccgccgagaacgttgcgcaggcgttctcgattacgcgt
gaacaatccgatgcctatgcgctggagagccaccggcgcgccagcgcggcgcatgcccag
ggcctgttccgcgatgagatcgtggcgctggatgtgccgcagcgcaagggaccggcgctg
cgtttcgagaaggatgaaggcgtgcgcgccgaggccagtctgtccgccctggcgcgtttg
aggccgttgctggacggcggggtcgtgacggccggcaatgccagccagcaaagcgatgcc
gctgccgcctgcctggtggtggccgaagaccaactggagcgcctggggctggagccgatg
ggatatctggtcggctgggcggcggcgggctgcgagccggccaccatgggcatggggccg
gtgccggcgactgcgaagctgatggcgcgactgggtttgtccttggcggacatggatctg
atcgaggtcaatgaggcgtttgcctgccaggtgctggcggtgctgcggcaatggggactg
cacgatcacgcccgggtgaacgtcaatggctccggcatctcgctggggcacccgatcggc
gcgaccggggtgcgcatcatggccagcctgttgcacgaaatgaaacggcgcggcgcccgc
tacgcgctggaaaccatgtgcgtgggcggcgggcagggcgtggccgccgtgtttgagcgg
gcgtga

DBGET integrated database retrieval system