KEGG   Kyrpidia tusciae: Btus_0037Help
Entry
Btus_0037         CDS       T01220                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bts  Kyrpidia tusciae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Btus_0037
DNA repair and recombination proteins [BR:bts03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Btus_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
37057..37656
Genome map
AA seq 199 aa AA seqDB search
MVNFPEPISQLIDGFMKLPGIGPKTAQRLAFHVLRMPDEDVLHLSQALVAVKKDLRYCRI
CCNITDVDPCTLCRDELRDHRVICVVQDPRDVAAMERTREYHGVYHVLHGAISPMEGIGP
EDIRVKELLERMKNDLPKELILATNPTVEGEATAMFLTRLVKPLGVKVTRIARGLPMGGD
LEYADELTLSQALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtgaactttccggaacccatctcgcagctcatcgacgggtttatgaaattgccggga
atcggtcctaagaccgctcaacgcttggcttttcacgttctccggatgcccgacgaagat
gtcctgcacctatcccaggccctggtggcggtcaaaaaggacctccggtattgccggatc
tgctgcaacattaccgatgtcgatccttgtaccctttgtcgcgatgagctgcgggatcac
cgggtgatctgcgtggttcaggatcccagggatgtcgcggcgatggaacgcacccgggaa
taccatggggtatatcacgtgcttcacggggcaatttcgccgatggaagggattggcccc
gaggatattcgagtgaaagaattactggaacgcatgaagaacgatttgccgaaagagttg
attctcgccacaaaccccaccgtggaaggggaagcgacagcgatgtttttaacccggctg
gtcaaaccgctgggggtgaaggtgacccggatcgcccgggggttgcccatggggggagat
ctcgagtatgcggacgagttgacgctgtcccaggctctggaaggccgccgagaaatttaa

DBGET integrated database retrieval system