KEGG   Kyrpidia tusciae: Btus_0064Help
Entry
Btus_0064         CDS       T01220                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bts  Kyrpidia tusciae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Btus_0064
Enzymes [BR:bts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Btus_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
60377..61297
Genome map
AA seq 306 aa AA seqDB search
MVCEKAPAKINLSLDVLYRRDDGYHEVEMVMQTVDLADRVYLEEAADFQLSCTHPKLPTD
ERNLALRAAKLLQQETGCHRGASIHLDKRIPLSAGLAGGSSDAAAVLRGLNRLWGLGLTT
DELAELGAKLGSDVPFCVYGGTALAQGRGERITILPSCPPAWVILVHPPIPVSTAAVYGR
LRLDKVTEHPKTAQMVEAIREKDLGRISQRLGNVLETVTFDLYPEVRRLKARMVQFGASG
ALMSGSGPTVFGLVDRQSKAERIYHAFRGFVREVYLTRVCGLNDDIVGKRREPDGCDRPR
GRERFR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggtttgtgaaaaagcaccggcaaaaatcaacctgtctttggacgtgctgtaccgtcgg
gatgacggataccatgaagtagaaatggtcatgcaaacggtggatttggctgaccgggtg
tacctagaggaggccgcggatttccaattgagttgcactcaccccaagctgcccaccgac
gaacgcaacctagctctccgggcagcgaaattgttgcagcaagagacgggttgtcatcgc
ggcgcatcgattcacctcgacaaacgcatcccgttgtcggcggggctcgcgggcgggtcc
agcgacgctgcggcggtgctaagaggtctcaatcgtttgtgggggctggggttgaccaca
gatgaactggcggaactcggggcaaagctggggtcggatgtgcccttttgtgtgtacggc
ggcacggcgctcgcccaagggcggggagagaggatcacgatcctgccgtcctgccctccg
gcgtgggtaattctggttcacccacccattccggtgtccaccgccgcggtctacgggagg
ctacggctagataaggtgacggaacacccgaaaacggcccagatggttgaggcgattcgc
gagaaggaccttgggcgcatctcccagcggctcggcaacgtcttagagacggtcaccttc
gatctttatccggaagtgaggcggctcaaagcccgaatggttcagtttggtgcttcaggg
gcgttgatgtcgggcagcggccccacggtgttcggcctggtggacaggcagtcgaaggcg
gaacgaatttatcatgcctttcgcggcttcgtccgggaagtgtatctgacccgggtgtgc
ggtttaaacgacgacattgtgggaaagcggagggaacctgatggatgcgatcgtcctcgc
gggagggagcgtttccgataa

DBGET integrated database retrieval system