KEGG   Kyrpidia tusciae: Btus_0105Help
Entry
Btus_0105         CDS       T01220                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bts  Kyrpidia tusciae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bts00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
100651..101190
Genome map
AA seq 179 aa AA seqDB search
MNGSETIHDVYFGLGANLGDRETHLRQAVAGLQRGLEPIRIKLSSLYETDPVGVEDQPLF
LNACLFLRTAAPVQVVHQVARDTETRLGRIRTIRWGPRTIDIDILLFDNLVVNTPELQIP
HPRMHERIFVMVPMAELAPELRHPVLGQTMAEIAEQVRKKGGIRRWKIGWEAEYAPFEN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggttccgaaacgattcatgacgtgtacttcgggctcggggccaaccttggcgat
cgggaaacccacctccgccaggccgtggccggtttacaacggggccttgaaccgattcgc
ataaagctatcctctctttatgagaccgatcccgtcggtgtcgaagaccagccgctgttc
ttgaatgcctgtctgtttttgcggacggcggcacccgtgcaagttgttcatcaagtcgcc
cgggatacggagacccgactcggcaggattcgaacaatccgatggggtccccgaaccatt
gacatcgatatccttttgttcgataacctggtggtgaacacgccggagttacagattcct
catccccggatgcacgagcgcattttcgtgatggtacccatggcagagttagctcccgaa
ctccgccaccctgtgctcgggcaaacgatggccgagattgctgaacaggtccgcaagaag
ggtgggattcgccggtggaaaatcggctgggaagcagaatacgcgcctttcgaaaactga

DBGET integrated database retrieval system