KEGG   Kyrpidia tusciae: Btus_0184Help
Entry
Btus_0184         CDS       T01220                                 

Definition
tRNA pseudouridine synthase A (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
bts  Kyrpidia tusciae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
169191..170024
Genome map
AA seq 277 aa AA seqDB search
MYVKAKVGYDGTDYHGFQRQPGLRTVQGVLEGALGELAGREVSIVGAGRTDAGVHARGQV
IAFEWPGPIPWQRLERVLLRRLPEDLVVSNLEPAPESFHPRFSAVGKCYRYTLDQGVYPS
VFLRRYTWHVPTQMDLGSMRRAALAAAGTHDYTSFCAASTPVQNKVRTVYAIRLAEEPPF
VHLYVFGNGFLYQMVRILVGTLVEVGIGKRSVESISGILAARDRRAAGVTAPAKGLTLWD
VYYETGDFTRAWSGFLDLTAAAQYNEHGVFGPWNHEG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgttaaggcgaaggtgggttacgatgggaccgattatcacggattccagcggcaa
cccggcctgagaacagttcagggggtgctggaaggggccttaggggagttggccggccgg
gaggtttcgattgtcggggcggggcggacagatgccggagtgcacgcccggggacaggtg
atcgccttcgagtggccgggaccgattccctggcagcgattagagcgggttttgcttcgg
cggctgccggaagatctggtggtatccaatcttgaaccggcgccggagtcctttcacccg
cgtttttccgcagtgggcaaatgctatcgttacaccctggatcaaggggtgtatccctcg
gtgtttctccgccgctatacgtggcacgtaccgactcagatggatctggggtcgatgcgc
cgggcggccctcgcggctgcagggactcacgattataccagcttttgcgccgccagcact
ccggtacagaacaaggtgcggacggtatacgccatccgcctggccgaggagccgcctttt
gtccacctttacgtgtttggcaacggctttctgtaccagatggtccgcatcctggtcggc
accctggtggaggtggggatcgggaagcgatcggtcgagtctatctccgggattttggcc
gcccgggatcgtcgggcggcgggagtgacggcccctgctaaagggctgaccttgtgggac
gtgtactatgagacgggcgatttcacccgagcttggagcggttttcttgacttgactgcg
gcagctcagtacaatgagcatggagttttcggcccatggaaccacgagggttga

DBGET integrated database retrieval system