KEGG   Kyrpidia tusciae: Btus_0192Help
Entry
Btus_0192         CDS       T01220                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bts  Kyrpidia tusciae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Btus_0192
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Btus_0192
Enzymes [BR:bts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Btus_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
175179..176090
Genome map
AA seq 303 aa AA seqDB search
MMVARIEVLGVPLDLGQGRRGVDMGPSAIRYAGLQDRVRALGFEVQDLGNVSVPEPEAKE
IQDPKLKYLPEIERVSEEIAARVSEVLKRGSMPVILGGDHSLAIGSLAGVALAKARVGVI
WFDAHGDMNTQETTPSGNIHGMPLAASLGLGHPGLTRVAGFAPKVRPENVVLVGARSIDE
GEARLIRKSGLRVFTMHEIDRQGIGAVMEEAIRIASRGVDGVHLSLDLDALDPMTAPGVG
TPVRGGITYREGHLAMELLAEAGVLCSVDVVEVNPILDVANRTAEMAVDLLCSALGKKIL
PDS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatggtggccagaatcgaggtcctcggcgtcccgttggatctggggcagggacgccga
ggggtggacatggggcccagtgccattcggtatgcgggtcttcaggaccgagtgagggcc
ctcgggtttgaggtacaggatctcggcaacgtgtcggtgccggaacccgaggccaaggaa
atccaagatccgaagttgaaatatcttccagaaattgaacgtgtcagcgaggagattgca
gccagggtttcggaagtcctcaaacgcgggtcgatgcccgtgatcctcggcggagatcac
agcttggccatcggttctctggccggcgtggcattggccaaggcgcgggtcggggtgatc
tggttcgacgcccatggggatatgaatacccaggaaaccactccctccggcaatatccac
ggaatgcctctggcggcgtctctggggctcggacaccccggtctgacccgggtggcgggg
tttgccccgaaggttcgaccggaaaatgtggttcttgttggcgcccggtctatcgatgaa
ggtgaggcgcgcttgattcggaagtcggggctgcgcgtgttcaccatgcatgagatcgat
cggcagggcattggagcggtgatggaagaggcgatccgcatcgcgtcccggggcgtagac
ggggttcatctgagtttggatttggatgccttggatcccatgaccgccccgggggtggga
accccggtgcggggagggatcacttaccgagaaggacacctggccatggaacttctcgcc
gaagcgggagtcttgtgttccgtagacgtggtggaggtcaacccgatcttggatgtcgcc
aaccggacggccgagatggcggtggacctgttgtgctcggctctggggaaaaagatcctg
ccggattcttga

DBGET integrated database retrieval system