KEGG   Kyrpidia tusciae: Btus_0488Help
Entry
Btus_0488         CDS       T01220                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bts  Kyrpidia tusciae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bts00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
483487..484560
Genome map
AA seq 357 aa AA seqDB search
MDASLELLRELTEAPGAPGAEGPVRELMRKHLEGLTDEVSQDGLGSIVGKKVGDPAGPKV
MVMGHMDEVAFLVTHITPEGFLRFETLGGWWEQVMLAQRVRVLGRKGEIIGVIGSKPPHV
LPKEERDKVVRKKDMFIDIGAGSREEAMELGVRPGDPVVPICPFTVLSGGKFIMAKAIDN
RSGCAAVIDVLRRLKDTDHPNVVYAGATVQEEVGLRGAQTAAQWIQPDVFIAVDVGIAGD
TPGLSEREALGKCGQGPLVLLYDATLVPNGPLRDLVIDTAEELGIPYQFDAMAGGGTDAG
RAHLAGRGIPSIVIGFPTRYIHSHAALLHRDDYDRAVRLLTEVVRRLDRETVDRLMQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttcactggagttgttgagggagttaacggaagcccccggcgccccgggagcc
gaggggcctgtacgggaattgatgaggaagcatctcgaggggctgaccgacgaagtttcg
caggatggccttggcagcattgtcggcaagaaggttggggatcctgcgggtcccaaggtc
atggtcatggggcatatggatgaagtggcttttttggtcacccatatcaccccggagggt
tttttgcgttttgagaccttgggcggttggtgggagcaggtgatgttggcccagcgggtg
cgggtcctcgggcgaaaaggggagatcatcggtgtgatcggttccaaacctccccatgtt
ctcccgaaggaagagcgggacaaggtggttcggaagaaggacatgtttattgacattggc
gccgggagccgggaagaggcgatggagttgggcgtgcgacccggcgatccggtggtgccg
atttgtccgttcaccgtcctgtcgggaggcaaatttatcatggcgaaggcgatcgacaat
cgctcgggttgcgcggcggtgatcgacgtcctgcgccgattgaaagataccgaccatccc
aacgtcgtgtatgccggggccacggtgcaggaagaagtgggtttgcggggcgcgcaaacg
gcggctcaatggattcagcccgatgtgtttatcgccgtggatgtgggcatcgccggagac
acccccggcttgtcggagcgcgaggcgctcggcaagtgcggtcaagggccgctcgtcctt
ctctacgacgccacgttggtaccgaacggtccgctccgggatctggtcatcgatacggcg
gaagaattggggatcccgtaccagtttgacgccatggccgggggaggaaccgatgcgggc
cgggctcatctggcagggcgggggatcccctctatcgtgatcggatttccgactcggtac
attcacagtcacgcggctctgctgcaccgggatgattatgaccgagcggtacggttgctg
actgaggtggtgaggcggctggaccgggaaacggtggaccgcctgatgcagtag

DBGET integrated database retrieval system