KEGG   Kyrpidia tusciae: Btus_0488Help
Entry
Btus_0488         CDS       T01220                                 

Definition
(GenBank) Cellulase
Organism
bts  Kyrpidia tusciae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADG05256
JGI: Btus_0488
UniProt: D5WTT6
Position
483487..484560
Genome map
AA seq 357 aa AA seqDB search
MDASLELLRELTEAPGAPGAEGPVRELMRKHLEGLTDEVSQDGLGSIVGKKVGDPAGPKV
MVMGHMDEVAFLVTHITPEGFLRFETLGGWWEQVMLAQRVRVLGRKGEIIGVIGSKPPHV
LPKEERDKVVRKKDMFIDIGAGSREEAMELGVRPGDPVVPICPFTVLSGGKFIMAKAIDN
RSGCAAVIDVLRRLKDTDHPNVVYAGATVQEEVGLRGAQTAAQWIQPDVFIAVDVGIAGD
TPGLSEREALGKCGQGPLVLLYDATLVPNGPLRDLVIDTAEELGIPYQFDAMAGGGTDAG
RAHLAGRGIPSIVIGFPTRYIHSHAALLHRDDYDRAVRLLTEVVRRLDRETVDRLMQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttcactggagttgttgagggagttaacggaagcccccggcgccccgggagcc
gaggggcctgtacgggaattgatgaggaagcatctcgaggggctgaccgacgaagtttcg
caggatggccttggcagcattgtcggcaagaaggttggggatcctgcgggtcccaaggtc
atggtcatggggcatatggatgaagtggcttttttggtcacccatatcaccccggagggt
tttttgcgttttgagaccttgggcggttggtgggagcaggtgatgttggcccagcgggtg
cgggtcctcgggcgaaaaggggagatcatcggtgtgatcggttccaaacctccccatgtt
ctcccgaaggaagagcgggacaaggtggttcggaagaaggacatgtttattgacattggc
gccgggagccgggaagaggcgatggagttgggcgtgcgacccggcgatccggtggtgccg
atttgtccgttcaccgtcctgtcgggaggcaaatttatcatggcgaaggcgatcgacaat
cgctcgggttgcgcggcggtgatcgacgtcctgcgccgattgaaagataccgaccatccc
aacgtcgtgtatgccggggccacggtgcaggaagaagtgggtttgcggggcgcgcaaacg
gcggctcaatggattcagcccgatgtgtttatcgccgtggatgtgggcatcgccggagac
acccccggcttgtcggagcgcgaggcgctcggcaagtgcggtcaagggccgctcgtcctt
ctctacgacgccacgttggtaccgaacggtccgctccgggatctggtcatcgatacggcg
gaagaattggggatcccgtaccagtttgacgccatggccgggggaggaaccgatgcgggc
cgggctcatctggcagggcgggggatcccctctatcgtgatcggatttccgactcggtac
attcacagtcacgcggctctgctgcaccgggatgattatgaccgagcggtacggttgctg
actgaggtggtgaggcggctggaccgggaaacggtggaccgcctgatgcagtag

DBGET integrated database retrieval system