KEGG   Kyrpidia tusciae: Btus_0653Help
Entry
Btus_0653         CDS       T01220                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bts  Kyrpidia tusciae
Pathway
bts00860  Porphyrin and chlorophyll metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Btus_0653
Enzymes [BR:bts01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Btus_0653
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Btus_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADG05416
JGI: Btus_0653
UniProt: D5WUM6
Position
648544..650103
Genome map
AA seq 519 aa AA seqDB search
MGEGEGRTGKPGTVYLVGAGPGDPGLITVKGMECLKKADAVVYDRLASPRLLRCLRPGAE
RIYVGKAEGRHTLTQDEIQELLVRLAQDGKTVVRLKGGDPFVFGRGGEEAEFLVEHGIPF
EVVPGVTSAVAVPAYAGIPVTHRDHTPSFAVVTGHEDPEKETSWIDWDRLSTGVGTLIFL
MGVGRLAGIVEQLTAHGRPGTTPVALIRWGTRMEQETVTGTLDTIVDEVRRRNFGSPAVI
VVGEVVGLRKRLNWFERKPLFGKRILVTRAREQASALSAQIEDLGGEAVEFPAIRIEPPA
SWADLDEALTRSDLKWIVLTSRHAVESVWSRMRALELDVRRLSGVRMAAVGPATAGALRE
RGVIPEFTASDYRGQALAETLVPHIASGDVILLPRSNLASRDVPEVLSAAGAAVVEAEAY
RTEPGYEGAEEVRGLLREGRIHAVTFTSSSTVRFFLQGIGEEARPWLEHVPAFCIGPVTA
ATARELGLKVAGVAEQATVDSLVDLLAREMEAGAIRNGG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgaaggggaagggcggaccgggaaaccggggacggtgtacttggtgggggctggt
ccgggggatcccgggttgatcacggtaaagggcatggagtgtttaaagaaggccgatgcc
gtggtgtatgatcgcctggcttcgccccggctgctgcgctgccttcggccgggcgccgag
cggatttacgtgggaaaggcagagggccggcacaccctgacccaggatgagatccaggaa
ctgttggtgcgcctggcccaggatgggaaaacggtggtccgcctgaaggggggagacccc
tttgttttcggccggggaggagaagaggccgagtttctggtggagcatggcattcccttt
gaagtggtgccgggggtgacttcggcggtggcggtgccagcctatgcggggattcctgtg
acccatcgggaccatacgccttcctttgcggtggtcaccggccacgaggatccggagaaa
gagacgtcgtggatcgattgggaccgactgtccaccggggtgggcacgttgatttttctc
atgggggtcgggcggctagccggcattgtcgagcagttgaccgctcacggccgcccgggc
acgacgccggtggcactgatccgctggggcacccggatggaacaggaaacggtgaccggg
actttggacaccatcgtcgacgaggtccgaaggcggaactttggttccccggcggttatt
gtggtgggagaagtggtgggcctccggaagcggctgaactggtttgaacggaagccgctt
tttggcaagcgcattctcgtgacccgggcccgggaacaggcctctgcgttgtcggcacag
atcgaggatttgggcggggaagcggtggagttcccggcgatccgaattgaacccccggcg
tcctgggcagatttggatgaggcgctgacccggtcagacctgaagtggattgtgttgacc
agccgtcacgccgtggagagcgtatggtcccgtatgagagcgctggagttggacgtccgt
cggttgtccggggttcggatggcagcggtgggcccggcgacggcgggggcactgcgggag
cggggagtcattcctgagttcacggcttcggactaccggggccaagccttggcagagacc
cttgttcctcacatcgcctccggggatgtgatcctcttgccccgatcgaacctcgcgtcc
cgggatgttccggaggtgctttccgcggctggagccgcggtggtcgaggcggaggcgtac
cggacggagcctgggtacgaaggggcggaggaggttcggggcctgctccgggaggggcgg
attcacgccgtgactttcaccagttcgtctacggtgcgattttttctccagggcatcggg
gaagaggcgaggccgtggctagagcatgttcccgccttttgcatcggcccggtgaccgca
gccactgcccgggaactggggctgaaggtggcgggggtggccgagcaggccaccgttgat
agcttggtggaccttttggcccgggagatggaagccggggccatacgaaacggggggtga

DBGET integrated database retrieval system