KEGG   Kyrpidia tusciae: Btus_0654Help
Entry
Btus_0654         CDS       T01220                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bts  Kyrpidia tusciae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bts00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
650108..651085
Genome map
AA seq 325 aa AA seqDB search
MQFDRHRRLRWTPGMRDLWRENRLSIEALMYPLFAVHGSGVREPISSMPGVEHLSVDELR
REAVELAELGVRSILLFGIPAHKDERSSEAYDEGGIVQQAIRAVKEEVPEMVVATDVCLC
QYNPAGHCGIVRNGVILNDETLPLLARTALSHAAAGADLVAPSDMMDGRVKMIRSALDER
GFEHVPVMSYAVKYASAFYGPFREAADSAPQFGDRRSHQMDPANRREAIREARSDLDEGA
DVIMVKPAMAYMDIIRDLRERLDVPVAAYQVSGEYSMIKAAGLRGWIDERAVVLESLLGL
RRAGADLIITYFAKDVARWLREDRG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgatcggcatcgccggttgagatggacgccgggcatgcgagatctgtggcgg
gagaaccgcctttcgatagaggcactcatgtacccactttttgcggtgcacggcagcggg
gttcgggagccgatttcctccatgcccggcgtggagcacctgagtgtggatgagcttcgc
cgggaagcggtggaactggcggagctcggggtgcggtcgattctgttgttcgggatcccc
gcccacaaagacgagcgaagttccgaggcttacgatgaggggggcatcgtgcaacaggcc
attcgcgcggtcaaagaagaagttccagagatggtggtcgccaccgacgtctgtctctgt
cagtacaatcccgccggacattgcggcatcgtccggaatggcgtcatcctcaatgacgaa
accctccctctcctggcgcgaaccgctctttcccacgccgccgccggggccgacctggtg
gcgccctccgacatgatggacggacgggtgaaaatgattcggtcggctctggacgagcgc
ggctttgagcacgtgcccgtcatgtcctacgcggtgaaatacgcgtccgcgttctacggt
ccgttccgggaagcggcggattccgccccgcagtttggcgaccggcgaagtcatcaaatg
gaccccgccaaccgccgggaggcgatccgggaagcccggagcgatctcgacgaaggggcg
gacgtcattatggtcaagccggccatggcctacatggacatcattcgggaccttcgcgag
cgattggatgtccctgtggccgcttatcaggtgagcggggaatattccatgattaaggcg
gcgggcctgaggggatggatcgatgaacgggcggtggttttggaatcgctgttgggactg
cgccgggccggggcggatctgatcatcacgtattttgccaaagatgttgcccgttggctc
cgggaagatcggggataa

DBGET integrated database retrieval system