KEGG   Kyrpidia tusciae: Btus_0704Help
Entry
Btus_0704         CDS       T01220                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bts  Kyrpidia tusciae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Btus_0704
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Btus_0704
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Btus_0704
Enzymes [BR:bts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Btus_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
698546..699619
Genome map
AA seq 357 aa AA seqDB search
MWRGVVEEYREFLPVEPDTEPISLQEGNTPLIYARQLSERTGLEIWLKYEGLNPTGSFKD
RGMAMAVTKAKEDGAKVLICASTGNTSASAAAYAARAGMRAVVVIPDGKIAQGKLAQAYM
YGAQVVAVRGNFDQALAIVRHLAETHPVTLVNSVNPFRIEGQKTAAFEICDELGEAPDVL
AIPVGNAGNITAYWKGFVEYHLHRRTRHRPRMFGFEAEGAAAIVRGKPIAHPETIATAIR
IGNPASWNGAVQAVEQSGGMMGAVTDEEILEAYRWVAREGIFCEPASAASVAGLVKARAE
GRLEKGLTAVCVLTGNGLKDPDTALLHAPGRAEGPQVVEATEKAVVDAMMGSEALRS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggggtgtcgtggaggagtaccgagagttcttgcccgtggagccggatacggag
ccgatcagcctgcaagaaggcaacacaccgcttatctatgcccgacaactgtccgagcgc
accggcctcgagatttggttaaagtacgaaggccttaatcccacaggttcgtttaaagac
cgcgggatggccatggcggtgacaaaagcgaaagaggacggagccaaggtgttaatttgc
gcgtccacggggaatacatcggcgtcagccgccgcctatgcggcccgggcgggcatgcgc
gcggtggtggtaatcccggatggaaagatcgcccaggggaaattggcccaggcgtatatg
tatggagcccaggtcgtcgcagtccgggggaattttgaccaggcgttggcgatcgttcga
catttggccgagacccatccggtgactctggtgaactccgtcaacccttttcggattgag
ggccagaaaacggcggccttcgagatttgcgacgagctgggggaagcacccgacgtgctt
gcgattccagtgggcaatgccggtaacattaccgcatattggaaaggatttgttgagtat
caccttcatcggcgtacccggcatcgcccgcgcatgtttggtttcgaggcggaaggtgcg
gcggccatcgtgcggggaaagccgattgctcacccggaaacgattgccacagccatacga
attgggaatcccgcgagctggaacggggcggtgcaggcggtggagcaatccggcgggatg
atgggcgcagtaacggacgaggagattctcgaggcttaccgatgggtggctcgggaaggg
atcttctgtgagcccgcttccgccgcctcggtggcgggactggtcaaagcccgagccgag
gggcggctggaaaagggactgacggccgtctgcgtcttgaccggcaacgggctcaaagat
ccggatacagcgttgctgcacgcccctggacgggctgagggcccgcaggtggtggaggcc
accgagaaagcggtggtcgatgcgatgatgggttcggaagcgcttcggtcgtga

DBGET integrated database retrieval system