KEGG   Kyrpidia tusciae: Btus_0786Help
Entry
Btus_0786         CDS       T01220                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bts  Kyrpidia tusciae
Pathway
bts00010  Glycolysis / Gluconeogenesis
bts00620  Pyruvate metabolism
bts00640  Propanoate metabolism
bts00680  Methane metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_0786
   00620 Pyruvate metabolism
    Btus_0786
   00640 Propanoate metabolism
    Btus_0786
  Energy metabolism
   00680 Methane metabolism
    Btus_0786
Enzymes [BR:bts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Btus_0786
Lipid biosynthesis proteins [BR:bts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Btus_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MotCF
Motif
Other DBs
NCBI-ProteinID: ADG05545
JGI: Btus_0786
UniProt: D5WVD5
Position
776522..778486
Genome map
AA seq 654 aa AA seqDB search
MLDQDRPKIIQDSRKIAPPATYVPKSYVQGEEAYRSLYRESVEYPESFWAAVASELTWIK
PWETVMEGDFPDFSFFRGGYLNVSENCVDRHALGFRRNKVAIFWEGENGERRIITYLRLH
EKVQKFANVLKKCGIQKGDVVSVYMQNLPETFVALLAILRIGAVYNTVFAGFSPEALRER
VVDSKAKMVVCANRSYRRGRPIPLKENVDRALEGVDTVKTVIVYRRSDEQVPMTPGRDYD
WHELMAEAEPICPVEPMEANEPGLLIYTSGTSGKPKGIVHAGGGFLVGTYAYTKYQLDLR
DEDVYWNTADIGWLTSHIFVLVGGLALGVTTVLYEGALDYPHPGRLYEMVERYRVNKLFS
APTAYRMLVKNGEELARRYRLSTLELFASVGEPLNPEAWEWVYRVLGGGRAVINNTWGQT
ETGGTPLAGAPGAVEMKPGSCGVPFYGHSLDVVDGDGNPVPDGTPGFLVIRKPFPSLARD
IFGNRQRYVDTYFNVMPGVYFTGDSAIRDEDGHFWVLGRVDDVINVSGHRISTMEMESAL
ITHPKVVEAAVVGRPDPVKGAVPVAFVILEAGAERGPDLEKELEQWVADEIGSFARPAQV
YIVETMPRTRSGKIIRRMLRELIQEGKVQGDTTGLEDFDAVERILENLRGRTGF
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccaagatcgcccgaagataatccaagacagtcgcaaaattgcacctccagct
acttatgtgccaaaatcctacgtccaaggggaagaggcgtatcggtctctctaccgggag
tcggtagaatacccggagtccttctgggcggcagtggcctcggaactgacctggatcaag
ccctgggaaacggtgatggaaggagattttcctgacttttcctttttccgcggcggatat
ttgaatgtcagtgaaaactgtgtggaccggcacgccctgggttttcggcgcaataaagtc
gcaattttttgggagggggaaaacggagaacggagaatcatcacctaccttcgcttgcac
gagaaagtccaaaaatttgctaatgtcctcaaaaagtgtgggattcaaaaaggggatgtg
gtcagcgtttacatgcagaatctcccggaaacctttgtggctttgcttgcgattctgcgg
atcggggctgtttataacacggtgttcgccgggttttctcccgaggccctccgggagcgg
gtggtggactcaaaggcgaagatggtggtctgcgccaaccgcagctatcgccggggccgc
cccattcccttgaaggaaaatgtcgatcgggcgctggaaggggtcgacacggtgaaaacg
gtgatcgtgtaccggcgctccgacgagcaggtgcccatgactcccgggcgggattatgat
tggcacgaactgatggcggaagcggagcccatctgcccggtggagcccatggaagccaat
gagccgggtctcttgatctacacaagcggtaccagcgggaaaccgaaggggatcgtgcac
gccgggggcgggttcctggtggggacctacgcttacacaaaatatcaactggacctccgg
gacgaggatgtgtactggaacaccgctgacatcggctggttgacttcgcatattttcgtc
ctggtcggcgggctggccctcggggtgaccacggtgttgtacgaaggggcgctggattat
ccccaccccgggcgattgtacgagatggtggagcggtaccgggtcaataaactgttttcg
gcgccgacggcttatcggatgttggtgaaaaatggcgaggaactggctcggcggtaccga
ctgtcgacgctggagttgtttgcttcggtgggagagccgctcaatcccgaagcttgggaa
tgggtgtatcgcgtgctgggtggcgggcgcgcggttatcaacaacacctggggccagacg
gaaacgggggggacccctctggccggggcgccgggagcggtggagatgaaacccggctcc
tgcggagtgccattttatggacattccttggatgtggtggacggggacggaaatccggtg
ccggacggcaccccggggttcctggtgatccgcaagccgttcccgagcctggcccgggat
attttcggcaatcggcaacggtacgtggatacgtatttcaacgtgatgcccggcgtgtat
ttcaccggtgacagcgccattcgggacgaagatgggcatttctgggtgttggggcgggtg
gatgatgtgatcaacgtcagcggccaccggatcagcaccatggagatggaaagcgccctc
atcactcatccgaaagtggtggaggcggcggtggtgggccggccggacccggtcaaaggg
gcggtcccggtggcctttgtcatcctggaggccggagctgagcgggggccggatctggag
aaggaattggagcagtgggtggcggatgagatcggatcctttgcccgaccggcccaggtg
tatatcgtggagactatgccgcgaacccgttccgggaagatcattcgccgcatgttgcgg
gagttgatccaagaagggaaggtccagggagacaccaccgggctggaggattttgatgcg
gtggaacggattctggagaatttgcgcggccgaacggggttttag

DBGET integrated database retrieval system