KEGG   Kyrpidia tusciae: Btus_0827Help
Entry
Btus_0827         CDS       T01220                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bts  Kyrpidia tusciae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Btus_0827
   00052 Galactose metabolism
    Btus_0827
   00500 Starch and sucrose metabolism
    Btus_0827
   00520 Amino sugar and nucleotide sugar metabolism
    Btus_0827
Enzymes [BR:bts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Btus_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
819423..820346
Genome map
AA seq 307 aa AA seqDB search
MRKPVRKAVIPAAGLGTRLLPATKAQPKEMLPIVDKPAIQYIVEEAVAAGIEDIIIITGR
NKRAIEDHFDRNIELEMELEAKGDEKALEEVRRIAELADVHYIRQKQPRGLGHAVACAKS
FVGDEPFAVLLGDDVMFSERPCIAQLIDLYRETGGAVVGVQEVPRAEVSRYGIVDPNGPG
PGGVGHRARALVEKPSPEEAPSNLAIMGRYVITPEIFAILDDLPPGKGNEIQLTDGLNVL
CRTQGVWAMPFEGRRFDIGNPMGLLRASVEVALMREDIGPAMEAYLEELVRKGHALGRRM
YSRAADR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagccggtgcgaaaagcggtgattccggcagcggggttggggaccaggctgttg
ccggccaccaaggcccagcccaaagagatgttgcccatcgtggacaagcccgccatacag
tacatcgtcgaagaggcggtggcggcggggatcgaggacatcatcatcatcaccggaagg
aacaaacgggccatcgaagatcattttgatcgcaacatcgaactcgaaatggagcttgaa
gcaaagggcgatgagaaggccttggaagaggtgcggcggatcgccgagctggcggatgtc
cactacatccgccagaagcagccccgggggttgggacacgcggtggcctgcgcgaagagc
ttcgtcggcgacgagccctttgcggtgctcctgggggatgatgtgatgttctccgagcgg
ccgtgtatcgcccaacttatcgacctctaccgggagaccgggggggcggtggtgggggtc
caggaggtgccgcgggctgaggtgagccgttacgggatcgtggacccaaacggtccggga
cccggcggggtcgggcaccgggccagggcgttggtggaaaagccgtcgcccgaggaagcg
ccctccaacctcgccatcatggggcggtacgtgattacgccggagatttttgcgatcctc
gacgaccttccgccgggaaagggcaacgagattcagctcaccgacgggttgaacgtcttg
tgccgtacccaaggcgtgtgggccatgccctttgagggccggcgttttgatatcgggaat
ccaatgggtttgttgcgcgcctcggtggaagtggcgctgatgcgagaagacatcgggccg
gcgatggaggcgtatctggaggaactggtgcgcaaggggcatgccttggggcggcgaatg
tactccagggcggccgatcgctaa

DBGET integrated database retrieval system