KEGG   Kyrpidia tusciae: Btus_0947Help
Entry
Btus_0947         CDS       T01220                                 

Definition
ketol-acid reductoisomerase (EC:1.1.1.86)
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bts  Kyrpidia tusciae
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Btus_0947
   01230 Biosynthesis of amino acids
    Btus_0947
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Btus_0947
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Btus_0947
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase
     Btus_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
948666..949658
Genome map
AA seq 330 aa AA seqDB search
MSLKIYYEQDADLKLLDGKTVAVLGYGSQGHAQAQNLRDSGVSVVVGLRPGRSWKQAEAD
GFEVLSVAEATERADLIQILIPDERQAQTYREEMLPNLRSGQMLMFAHGFNIHFGQIDPP
ADVDVTMIAPKGPGHLVRRTFQEGTGVPALLAVHQDASGKAKEVALAFAKGIGATRAGVI
ETTFKEETETDLFGEQAVLCGGVSNLIKAGFETLVEAGYKPEIAFFECLHEMKLIVDLMY
EGGLSRMRYSISDTAEFGDYRSGPRIITEETRAEMRKILAEIQSGQFAREWILENQANRP
FFNARRKAEQNHPIEVVGGKLREMMTWINK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgtcattgaaaatctactatgaacaagacgcggatttgaaattgttggacgggaagacg
gttgcggtgctgggttacggcagtcagggccacgcccaagcgcaaaaccttcgcgacagc
ggcgtatcggtggtggtgggactgcggccgggccgctcctggaagcaggccgaggcggac
gggtttgaagtcctgtctgtggccgaggccaccgagcgggccgacctgatccaaatcctc
attccggacgagcgccaggcccagacctatcgggaggagatgctaccgaacctgcgcagt
ggccagatgctcatgttcgcccacggattcaatattcatttcggccagatcgatcccccg
gcggacgtggacgtgacgatgatcgccccgaagggtccgggacacctggttcggcgcacc
ttccaagaaggtaccggggtgccggcgctgctggcggttcaccaggacgcgtccggcaag
gccaaagaggtcgccctggcttttgccaaaggcatcggggcgactcgggccggggtgatc
gaaaccacgttcaaagaagaaaccgaaaccgacctgtttggcgaacaggcggtactgtgc
ggcggagtctccaacctgatcaaagccggtttcgagaccctcgtcgaagccggatacaaa
cccgagattgccttcttcgagtgtttgcacgagatgaaactgatcgtggatctcatgtat
gagggcggattatcccggatgcggtactccatcagcgatacggcggagtttggggactac
cggagcgggccccggattatcaccgaggaaacccgggccgagatgcgaaaaattctcgcc
gagattcaaagtgggcaattcgcccgggaatggattctggagaaccaggccaaccggccg
ttcttcaacgcccggcggaaagcggagcagaatcatcccatcgaagtggtgggcggaaaa
ctgcgggaaatgatgacctggattaacaaatga

DBGET integrated database retrieval system