KEGG   Kyrpidia tusciae: Btus_0968Help
Entry
Btus_0968         CDS       T01220                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bts  Kyrpidia tusciae
Pathway
bts00360  Phenylalanine metabolism
bts00362  Benzoate degradation
bts00620  Pyruvate metabolism
bts00621  Dioxin degradation
bts00622  Xylene degradation
bts00650  Butanoate metabolism
bts01100  Metabolic pathways
bts01120  Microbial metabolism in diverse environments
bts01220  Degradation of aromatic compounds
Module
bts_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Btus_0968
   00650 Butanoate metabolism
    Btus_0968
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Btus_0968
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Btus_0968
   00622 Xylene degradation
    Btus_0968
   00621 Dioxin degradation
    Btus_0968
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Btus_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADG05707
JGI: Btus_0968
UniProt: D5WW75
Position
970680..971561
Genome map
AA seq 293 aa AA seqDB search
MKLKAAIVGSGNIGTDLMFKLLRSEWVEPRWMVGIDPESEGLRRAKELGLETSAEGLKAV
LDQGVRPDLVFDATSAKAHVRHAKLLREAGIQAIDLTPAARGPYVIAAVNLGEHLDAPNV
NMVTCGGQATVPMVYAVSRVVGVSYAEIVATIASKSAGPGTRQNIDEFTETTAKALEVIG
GARKGKAIIILNPAEPPILMRDTIYCLIDETGDEVYERIDQSIRAMVAHVQEFVPGYRLN
RDPIYRDNLVSISIEVEGLGDFLPVYAGNLDIMTAAATKVGEEFAKSRLAIQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgaaggcggccatcgtagggtcggggaacattgggacagacttgatgtttaag
cttttgcgcagtgaatgggtggaaccgcgttggatggtcgggatcgatccggagtccgag
gggctgcgtcgggcgaaggagctgggcttggagacgtcggcggaggggctcaaggcggtg
ctggatcaaggggttcggccggacctggtgtttgacgccaccagtgccaaagcccacgtg
cgccatgccaaattgttgagagaggcgggcattcaagcgatcgatttgacgccggccgcc
aggggcccgtatgtcatcgctgcggtgaatctgggagagcacctggatgcgcccaacgtg
aacatggtgacctgcggaggtcaggcgacggtaccgatggtgtatgccgtcagccgggtg
gtgggggtgtcctacgccgagatcgtggccaccatcgccagcaagagcgccggaccgggg
acgcggcaaaacatcgacgagtttacagaaaccacggccaaggcgctggaggtcatcggc
ggagcccgaaaagggaaggcgatcatcattctgaatccggcggagcctccgattctcatg
cgggacacgatttattgtttgatcgacgagaccggggacgaggtttatgagcggatcgac
cagtccatccgtgcgatggtggcgcatgtccaggagtttgttccggggtatcgcctgaac
cgggacccgatttatcgcgacaaccttgtgagcatctccattgaggtcgaaggactgggg
gattttctgcccgtgtacgccgggaatctcgatatcatgacggcggccgccaccaaagtg
ggcgaagaatttgccaaaagtcgcctggcgattcagcgttga

DBGET integrated database retrieval system