KEGG   Kyrpidia tusciae: Btus_0968Help
Entry
Btus_0968         CDS       T01220                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bts  Kyrpidia tusciae
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Btus_0968
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Btus_0968
   00650 Butanoate metabolism
    Btus_0968
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Btus_0968
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Btus_0968
   00622 Xylene degradation
    Btus_0968
   00621 Dioxin degradation
    Btus_0968
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Btus_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
970680..971561
Genome map
AA seq 293 aa AA seqDB search
MKLKAAIVGSGNIGTDLMFKLLRSEWVEPRWMVGIDPESEGLRRAKELGLETSAEGLKAV
LDQGVRPDLVFDATSAKAHVRHAKLLREAGIQAIDLTPAARGPYVIAAVNLGEHLDAPNV
NMVTCGGQATVPMVYAVSRVVGVSYAEIVATIASKSAGPGTRQNIDEFTETTAKALEVIG
GARKGKAIIILNPAEPPILMRDTIYCLIDETGDEVYERIDQSIRAMVAHVQEFVPGYRLN
RDPIYRDNLVSISIEVEGLGDFLPVYAGNLDIMTAAATKVGEEFAKSRLAIQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgaaggcggccatcgtagggtcggggaacattgggacagacttgatgtttaag
cttttgcgcagtgaatgggtggaaccgcgttggatggtcgggatcgatccggagtccgag
gggctgcgtcgggcgaaggagctgggcttggagacgtcggcggaggggctcaaggcggtg
ctggatcaaggggttcggccggacctggtgtttgacgccaccagtgccaaagcccacgtg
cgccatgccaaattgttgagagaggcgggcattcaagcgatcgatttgacgccggccgcc
aggggcccgtatgtcatcgctgcggtgaatctgggagagcacctggatgcgcccaacgtg
aacatggtgacctgcggaggtcaggcgacggtaccgatggtgtatgccgtcagccgggtg
gtgggggtgtcctacgccgagatcgtggccaccatcgccagcaagagcgccggaccgggg
acgcggcaaaacatcgacgagtttacagaaaccacggccaaggcgctggaggtcatcggc
ggagcccgaaaagggaaggcgatcatcattctgaatccggcggagcctccgattctcatg
cgggacacgatttattgtttgatcgacgagaccggggacgaggtttatgagcggatcgac
cagtccatccgtgcgatggtggcgcatgtccaggagtttgttccggggtatcgcctgaac
cgggacccgatttatcgcgacaaccttgtgagcatctccattgaggtcgaaggactgggg
gattttctgcccgtgtacgccgggaatctcgatatcatgacggcggccgccaccaaagtg
ggcgaagaatttgccaaaagtcgcctggcgattcagcgttga

DBGET integrated database retrieval system