KEGG   Kyrpidia tusciae: Btus_1003Help
Entry
Btus_1003         CDS       T01220                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bts  Kyrpidia tusciae
Pathway
bts00630  Glyoxylate and dicarboxylate metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01200  Carbon metabolism
Module
bts_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Btus_1003
Enzymes [BR:bts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Btus_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: ADG05741
JGI: Btus_1003
UniProt: D5WWP0
Position
complement(1000274..1001551)
Genome map
AA seq 425 aa AA seqDB search
MIDKQEAEALERSWETDPRWKGIVRTYSAEDVLRLRGSIRIEHTLARMGAERLWHLLHTE
PYVPALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPANSVPHVVKR
INQALQRADQIHHMEGKDDIYWFAPIVADAEAGFGGPLNVYELMKAMIEAGAAGVHFEDQ
LAAEKKCGHMGGKVLIPASQAIRNLTAARLAADVMGVPTILVARTDALAATMITSDIDPR
DQGFITGERTSEGFYRVRNGLEAAIARGLAYAPYADMIWCETSEPNLEEARLFAEAIHAK
FPGKLLAYNCSPSFNWKRKLDDAAIADFQKKLGQMGYKFQFVTLAGFHALNFSMFDLARQ
YKERGMAAYAELQQREFASEVYGYTATKHQREVGAGYFDEVSMVISGGTSSTTALTGSTE
EEQFV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacaaacaagaagcggaagcgttagagcgcagttgggaaacagatccccgttgg
aaagggatcgttcggacctattcggcggaagatgtgctacggcttaggggctcgattcga
atcgagcacaccctggcgcggatgggagccgagcgcctgtggcatctgctccatacggag
ccttacgtccccgccctgggggctttgaccgggaatcaagcggtgcaacaggtcaaagcc
ggactcaaggcgatctacctgagcggctggcaggtggcggcggacgccaatctcgccgga
cagatgtatccggatcagagcctgtaccccgccaacagcgttccccacgtggtaaaacgg
atcaaccaggctctgcaacgggcggatcagatccaccacatggagggcaaagatgatatc
tactggtttgcccccattgtggccgacgccgaggcgggattcggggggccgctgaacgtt
tatgagctgatgaaagcgatgatcgaagcgggagcggcgggcgtccactttgaagatcaa
ttggccgccgagaaaaagtgcggccacatgggaggcaaggtcctgatccccgcttcccag
gctatccggaatttgaccgcggcccggttggcggcggacgtgatgggggtgccgacgatc
ttggtggcccggaccgacgcgttggcggccaccatgatcaccagcgacatcgacccgcgg
gatcaaggatttatcaccggcgaacgcacctccgaaggattctacagggtgcgcaacggg
ctggaggcggccatcgcccgggggctcgcctatgctccgtacgcggacatgatctggtgc
gaaacctcggagccgaatctcgaagaggcgcgcctgttcgccgaagcgattcatgcgaaa
ttcccgggcaagttgttggcttacaattgttcgccgtccttcaactggaagcggaaactg
gacgacgccgccatcgccgacttccagaagaagttgggacagatgggatacaagttccaa
ttcgtcaccctggctggtttccacgccctcaatttcagcatgttcgacctggcgcggcaa
tacaaagagcgcgggatggccgcctacgccgagctgcaacagcgggaattcgccagcgaa
gtgtacgggtacacggcgaccaaacaccagcgcgaggtcggagcgggatattttgacgag
gtgagcatggtcatctccggggggacctcctccaccacggcgctcaccggttccaccgaa
gaggagcagttcgtctag

DBGET integrated database retrieval system