KEGG   Kyrpidia tusciae: Btus_1004Help
Entry
Btus_1004         CDS       T01220                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bts  Kyrpidia tusciae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Btus_1004
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Btus_1004
   00630 Glyoxylate and dicarboxylate metabolism
    Btus_1004
Enzymes [BR:bts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Btus_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1001597..1003270)
Genome map
AA seq 557 aa AA seqDB search
MPLLYYNSYFLRCVYQHTKRRDTMPETIAYPAGVQVTAPVDESYREILTPGALEFVADLH
RQFNGRRQALLAERQKRQAAIDGGQMPDFPAETAELRQADWTVAPIPADLLDRRVEITGP
AGDRKMVINALNSGAKTFMADFEDANSPTWENTVGGQINLRDAVRRTIRYVSPEGKRYEL
KDRTAVLIVRPRGWHLPEKHVLVDGEPISGALFDFGLYFFHNVRELLERGTGPYFYLPKM
ESRFEARLWNDVFNVAQDRLGIPRGTIKATVLIETILAAFEMDEILYELRDHAAGLNCGR
WDYIFSFIKRFRNRPEVILPDRGLVTMTAPFMRAYTQLTIKTCHRRGAMAIGGMAAQIPV
KNDPAANEEAFAKVRADKEREATDGHDGTWVAHPGLVPVAMEVFDRLMPTPNQLDRKRED
VHVSAADLIRVPEGPITEQGLRTNISVGIQYIEAWLRGSGAVPIFNLMEDAATAEISRAQ
VWQWIRHPRGVLEDGRKVTVELFRQVLDEELNKIKAELGEDRFAGGRYSEAAELFSRLTT
SDSFAEFLTLPGYELID
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctcctgtactataacagttatttccttcgatgtgtgtatcaacatacgaaaagg
agggacaccatgccagaaaccatcgcgtaccctgcgggcgtccaggtcaccgcacccgtt
gatgaatcctatcgggaaatcctgacccccggagcgttggagttcgtcgccgatctccac
cgtcaattcaacggtcggcgccaggcactcctggccgaaagacagaagcgccaagcggcc
atcgacggcggtcagatgccggattttccggctgagaccgcggaacttcgccaggcggat
tggacggtggcaccgatcccggccgaccttctggaccgccgggtggagatcaccggcccg
gccggagaccggaagatggtcatcaacgccctgaactccggcgccaaaacctttatggcg
gattttgaagacgccaactcccccacgtgggaaaacaccgtcgggggtcagatcaatctc
cgggatgccgtgcgccggacgatccggtacgtcagcccggaaggcaagcggtacgagctg
aaggatcgaacggcagtcctgatcgtccggccccggggttggcacctgccggagaagcac
gttttggtcgatggcgaaccgatctccggcgccctgtttgatttcggcctgtactttttt
cacaatgtccgggagttgctggagcgggggacggggccgtacttttaccttcccaaaatg
gaaagtcgcttcgaggcccggctgtggaacgatgtgttcaacgtggcccaagatcgcctg
gggattccccggggcaccatcaaagccacggtgttgatcgagacgatcctcgcggccttc
gagatggacgagatcctgtatgaactccgggatcacgccgctggactcaattgcggccgg
tgggactacatctttagcttcatcaaacgctttcggaaccgacctgaggtgattctgccg
gaccgcggcttggtgaccatgaccgcacctttcatgcgggcttatacgcagttgacgatt
aagacctgtcaccgtcgcggggcaatggccatcggggggatggcggcgcaaatcccggtc
aaaaacgatccggccgccaacgaagaggccttcgccaaggtgcgggcggacaaggagcgg
gaagcgacagatggccacgatgggacctgggtggcccatcccgggctggtgcctgtggct
atggaagtctttgaccggttgatgcccacgccgaaccaactggatcgcaagcgggaagac
gtacacgtttcggcggccgacctcatccgggtacccgaggggccgatcaccgagcagggc
ctgcgcaccaacatcagtgtggggattcaatatatcgaagcctggctgcggggatccgga
gccgtgccgattttcaacttgatggaagacgcggccacggcggagatctcccgggcccag
gtctggcagtggatccgccacccccgcggggtgctggaggacggaagaaaggtcacggtg
gagttgttccgacaagtcttggacgaggagttaaacaagatcaaggcggagctgggagaa
gaccgattcgccggcgggcggtactcggaagccgccgaactgttcagccgcttgaccacc
agcgattccttcgccgaatttttgactttgcccgggtacgagttgatcgattga

DBGET integrated database retrieval system